KEGG   Pseudohongiella spirulinae: PS2015_3022Help
Entry
PS2015_3022       CDS       T04158                                 

Definition
(GenBank) Selenide, water dikinase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
pspi  Pseudohongiella spirulinae
Pathway
pspi00450  Selenocompound metabolism
pspi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pspi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    PS2015_3022
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pspi03016]
    PS2015_3022
Enzymes [BR:pspi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     PS2015_3022
Transfer RNA biogenesis [BR:pspi03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    PS2015_3022
 Prokaryotic Type
    PS2015_3022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: ALO47647
UniProt: A0A0S2KI54
Position
complement(3299787..3300839)
Genome map
AA seq 350 aa AA seqDB search
MTDTPVRLTAYSHGAGCGCKIAPAVLDRILATQRQFAADPALLVGNSSKDDAAAYDIGNG
QVILSTTDFFMPIADDPFDFGRIAATNAISDIYAMGGRPLMAIAILGWPINVLSAEVAGQ
VVDGGRQACSDAGIVLAGGHSIDCPEPVFGLAVTGLVDKAKLKQNNTAQTGDLLYLSKPL
GVGVLTTAQKQGKLKPEHSTLARDVMCQLNRAGMALADVPGVTAITDVTGFGLMGHLVEM
CEGSGVDAELDIDAVPALAPIADYIALGCIPGGTGRNFDSYGSKLASITDAQKALLCDPQ
TSGGLLIAVRPDAAAAVEQLLAAHGVAPALIHPIGELSATRKEAVRVRFR
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacacgcccgtccgcctgaccgcctatagccatggcgctggttgcggctgcaaa
atagcgccggcagtactcgatcgtattctggcaacacagcgtcagtttgcagccgatcct
gctttactggttggcaacagcagcaaagacgatgcggctgcctatgacattggcaatggt
caggtcattctcagcaccaccgattttttcatgcccatcgcggatgatccgtttgatttc
ggacgcatcgctgccaccaatgccatcagtgatatatatgcgatgggcgggcggcccctg
atggccatcgccattttgggctggcccatcaatgtcctgagtgcggaggtggccgggcag
gtggtagacggcgggcgtcaggcctgttcggatgcgggcattgtgctggccggcgggcac
agtatcgactgcccagagccggtctttggtctggccgtcaccggtctggtcgataaagcc
aaactgaagcagaacaacaccgcgcagacaggggatctgctgtatctgagtaaaccgctg
ggtgtgggtgtgctcaccacggcgcaaaagcagggcaaattaaagcccgaacacagtacg
ttggcacgggatgtcatgtgccagcttaatcgcgccggcatggcacttgctgatgtgcca
ggtgtcacagccattaccgatgtgacaggttttggattgatggggcatctggtagagatg
tgtgaaggcagcggcgtggatgcagagctggacattgacgccgtacccgcgctggcacca
atcgccgactatatagcgctgggctgcattcctggtggtaccgggcgcaattttgacagc
tatggcagcaagctggcatcaataacagatgcacaaaaagccttgctctgtgacccgcaa
accagcggtgggttgctgattgccgtgcggccggatgcggcggctgcagtagaacagctg
ctggctgcgcatggagtggcgccagcccttattcatccgattggtgaactgtccgcaacc
cgcaaagaggctgtacgtgtccgattccgataa

DBGET integrated database retrieval system