KEGG   Pseudohongiella spirulinae: PS2015_867Help
Entry
PS2015_867        CDS       T04158                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pspi  Pseudohongiella spirulinae
Pathway
pspi00071  Fatty acid degradation
pspi00280  Valine, leucine and isoleucine degradation
pspi00310  Lysine degradation
pspi00362  Benzoate degradation
pspi00380  Tryptophan metabolism
pspi00620  Pyruvate metabolism
pspi00630  Glyoxylate and dicarboxylate metabolism
pspi00640  Propanoate metabolism
pspi00650  Butanoate metabolism
pspi00900  Terpenoid backbone biosynthesis
pspi01100  Metabolic pathways
pspi01110  Biosynthesis of secondary metabolites
pspi01120  Microbial metabolism in diverse environments
pspi01130  Biosynthesis of antibiotics
pspi01200  Carbon metabolism
pspi01212  Fatty acid metabolism
pspi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pspi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PS2015_867
   00630 Glyoxylate and dicarboxylate metabolism
    PS2015_867
   00640 Propanoate metabolism
    PS2015_867
   00650 Butanoate metabolism
    PS2015_867
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PS2015_867
   00072 Synthesis and degradation of ketone bodies
    PS2015_867
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PS2015_867
   00310 Lysine degradation
    PS2015_867
   00380 Tryptophan metabolism
    PS2015_867
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PS2015_867
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PS2015_867
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PS2015_867
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pspi04147]
    PS2015_867
Enzymes [BR:pspi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PS2015_867
Exosome [BR:pspi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PS2015_867
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ALO45539
UniProt: A0A0S2KBP6
Position
complement(901333..902532)
Genome map
AA seq 399 aa AA seqDB search
MSKDHVVILGGARTPIGGFQGVFSNTAAPALGVAAARAALERAGLNPSDNDSCIDDVLMG
CVLPAGLAQAPARQVALGAGLAVTTPCTTVNKMCGSGMKTVMMGVDQILAGNADTVLAGG
IENMTLAPYLIPKARGGLRLGHGELKDHMFLDGLEDAYTGRLMGSFAQETADKHGLTRKD
MDDYAIASLSRAQTAIKEGWFDAESVSLDVKAGRNDITVTHDEQPGKASVDKIPTLRPAF
AADGTVTAANSSSISDGAAAVVLMRESVARDNNLKPMARILAQASHARHPSEFTVAPIGA
IEKVLTKTGWSAADVDLFEINEAFAMVPLLAMRELGLPHDKVNIHGGACALGHPVGASGT
RIIVTLMYALQKLGKKRGIASLCIGGGEAVAIAIEMIDQ
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaagatcacgttgtaatcctgggcggcgcccgtacgcctattggtggctttcag
ggcgttttcagcaacacagcggcccctgcactgggcgtggctgctgcgcgcgcagcactt
gagcgcgccggccttaatccatcagacaatgacagctgtatagacgatgtattgatggga
tgtgtattgcccgccggactggcgcaggcgccggcccgccaggtcgcccttggtgcggga
ctggctgtgacaacgccctgtacaaccgtcaacaaaatgtgcggttctggcatgaaaacg
gtcatgatgggcgttgaccagattctggcaggcaacgcagacactgtgctcgccggtggt
atcgaaaacatgaccctggcaccctacctgatccccaaggctcgcgggggcctgcgcctt
ggccacggcgagctcaaggaccacatgttcctcgacggcctggaagatgcctacaccgga
cgattgatgggcagcttcgcacaagaaacagccgacaaacacggcctgactcgcaaggac
atggatgattatgccatcgcctcactgagccgcgcccagacagcgattaaagaaggctgg
ttcgatgccgaatctgtctcccttgacgtaaaagccggtcgcaacgacatcacggtgaca
cacgatgaacagcctggcaaagccagtgttgacaagatccccaccctgcgcccggccttc
gccgccgatggaactgtgacagcagccaattcttcatccatctcggatggagcagctgca
gtcgttctgatgcgcgaaagtgttgccagagacaataatctcaagcccatggcccgaatc
ctggcccaggccagccatgcccgtcaccccagcgaattcactgtggccccgatcggtgcc
atcgaaaaagtgctgaccaaaaccggatggagcgccgccgatgtcgatctgtttgagatc
aacgaggcctttgccatggtgccgctgctggcgatgcgtgaacttggcctgccgcatgat
aaagtcaatatccacggcggagcctgcgcgctgggacatccggtcggcgcatccggcacc
cgtatcattgtcacgctgatgtacgcgctgcaaaagctgggtaaaaagcgcggcattgcc
agtctttgtattggcggtggtgaagcagtagctatagccattgaaatgattgaccaataa

DBGET integrated database retrieval system