KEGG   Pseudohongiella spirulinae: PS2015_876Help
Entry
PS2015_876        CDS       T04158                                 

Definition
(GenBank) integrase
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
pspi  Pseudohongiella spirulinae
Pathway
pspi00250  Alanine, aspartate and glutamate metabolism
pspi00330  Arginine and proline metabolism
pspi01100  Metabolic pathways
pspi01110  Biosynthesis of secondary metabolites
pspi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pspi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PS2015_876
   00330 Arginine and proline metabolism
    PS2015_876
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pspi03000]
    PS2015_876
Enzymes [BR:pspi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     PS2015_876
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     PS2015_876
Transcription factors [BR:pspi03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    PS2015_876
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg PRODH
Motif
Other DBs
NCBI-ProteinID: ALO45547
UniProt: A0A0S2KB40
Position
910921..913962
Genome map
AA seq 1013 aa AA seqDB search
MKYARLPLQDSDTLDAVRAAYRVDEESQVIRLSQTLQWPSSTADAIRDRAGKLVTAVRAE
RRKGSGVDALMHEYQLSSEEGVVLMCLAEALLRVPDGATADRLIEDKLTAADWEGHLGHS
ESLFVNASTWGLVLSGRLLRQSLHDGHGKKVFRQWVQRCGEPVVRQAVRQAMRVMARHFV
TGRSIEEALQRSQGRANRAYRYSFDMLGEAARTQSDSERYFDAYVHAINAVGRQSGDMGP
LDAPGISVKLSALYPRFEMSQADRALPALTRKMVSLARLACHYDIGLTIDAEEADRLELT
MAVFDELLRQPQLAQWQGLGLAVQAYQKRAYDLLDWIASQARQNQRSVMIRLVKGAYWDT
EIKRAQEDGLDDYPVFTRKQNTDISYLACAQKLFSYQDCIYPQFATHNAYTVAAILELAD
PQQAFEFQRLHGMGEPLYDQLVTNNPELNCRVYAPVGSHEDLLPYLVRRLLENGANTSFV
NRIMDDQAPLESLTAHPQEQLKTLAQIPHPRIPLPADLYPDRRNSRGMDLSDVRALSALD
EQWQVLSGPSIPPVTDASIESALEGAFHYTEQWRLTDVNFRAGCLEALADLLEERMPHLI
ALCCQEGRKSIPDGVAEVREAVDFCRYYAAQARQLFDPQALPGPTGESNQWRLRGRGVFV
CISPWNFPLAIFLGQISAALVAGNTVIAKPAEQTPAIAWMATQLMYQAGIPEQALYLLAG
DAGTGARLVKDSRVAGVAFTGSELTARRINQALASREAAIATLIAETGGLNAMLVDSSAL
LEQVVVDVLRSGFQSAGQRCSALRILLVQEDVAPALIELLRGAMDELIIGDPADLATDVG
PVIDENALASLYEHIDYLEGNARLLKCCELSDSLSDTLYFAPRLYEISRIEQLSREVFGP
IVHLLRFRASDLDRVIDQINATGYGLTFGIHSRISSRAQTIASRINAGNVYVNRNMIGAV
VGVQPFGGSGLSGTGPKAGGPLYLTRFTNEQSISIDTTAAGGNASLFALSDDH
NT seq 3042 nt NT seq  +upstreamnt  +downstreamnt
atgaagtatgcacgactgccattgcaggactccgacacgcttgatgccgtcagagcggca
taccgggtggacgaggagtcgcaggttattcgcctgagtcagaccctgcagtggccgtcg
tcaaccgctgatgcaatccgcgaccgtgccggaaaactggtgacagccgtgcgcgcagag
cgtcgcaaaggttcaggtgttgatgccctgatgcatgagtatcagttatccagcgaggaa
ggcgtggtactgatgtgtctggcggaggctctgctgcgcgtcccggatggcgccacagct
gaccggctgattgaagacaagttgactgccgccgattgggaagggcatctgggtcacagt
gagtccttgtttgttaacgcgtcaacctgggggctggttttgtcaggcagattgctgcgc
cagtctctgcacgatgggcacggaaaaaaagtattcaggcaatgggtgcagcgctgcggt
gaacctgtggtgcgacaggctgtgcggcaggccatgcgcgtcatggctcgccactttgtc
acgggcagaagcattgaagaggcactacagcgttcgcaaggccgagccaatcgggcctat
cgatattcattcgacatgcttggcgaggccgctcgcacgcagtcggacagcgagcgctac
tttgatgcctatgtgcatgccatcaacgccgttggcaggcagtctggtgatatgggcccg
ttggatgcaccgggcatatctgtgaaactctcggcgctctacccacgttttgaaatgtcg
caggcggaccgcgcgctacccgcgttgacgcgaaagatggtctcgctggccagactggcc
tgtcactatgatatcgggttgacaatcgatgccgaggaggcggatcgcctggagctgacg
atggccgtgttcgacgaactgcttcggcaaccgcagctcgcacagtggcaggggctgggt
ctggccgtccaggcttatcaaaagcgggcttatgatctgctggactggatcgcgtcgcag
gcccggcaaaaccaacgatcagttatgatccggctggtaaaaggtgcttactgggataca
gaaatcaagcgtgctcaggaggacggtctggatgattatccggtgttcacccgcaaacag
aataccgatatatcctatctggcctgcgcacagaaacttttttcgtatcaggactgcatc
tatccgcaatttgctacccacaacgcgtataccgtagcggccattctggagcttgccgat
ccacagcaggcatttgaattccagcgcctgcatggcatgggtgaacctttatatgatcaa
ctggtgaccaacaatccagaactgaattgtcgggtttatgcaccggttggcagtcacgaa
gatctgctcccctatctggtccgccgcctgctggagaacggggcgaacacgtcttttgtc
aatcggattatggacgatcaggcgccgcttgaatcacttactgcgcacccgcaggagcaa
cttaagaccctggctcagattcctcatccacgcataccactaccggctgatctgtatccg
gacaggcgaaactccagagggatggatttgagcgatgttcgggccttgtctgccctggat
gaacagtggcaggtgttgtctggtccgtcgattccaccggtgacagacgcgtcgattgag
tcagcactggagggtgcctttcactacacagaacaatggcgcctgactgatgtgaacttt
cgtgcaggctgtctggaggctttggcagatctgcttgaggagcgcatgccgcatctgatt
gcgctgtgttgtcaggaaggtcgcaagagtatccctgacggtgtggctgaagttcgcgaa
gccgtcgatttttgccgatattacgctgcgcaggcgcgtcagttatttgatcctcaggca
ttacccggacctaccggggagtcgaatcaatggcgactaagagggcggggcgtgtttgtt
tgtatcagcccgtggaatttcccactggcgatatttctggggcagatcagtgcagcgctg
gtggctggcaacacggtgatcgccaaacccgctgaacagacgccggcaattgcctggatg
gcgacacagttgatgtatcaggcaggtattccggagcaggcgctttatttgcttgccggt
gatgccggcacaggcgcacgccttgtgaaagattcccgtgtagcaggggtggcattcacc
ggatcagagctgaccgcccgtcgcatcaatcaggcactggcctctcgagaggctgctata
gcgacattgattgccgaaacaggtggtctcaatgccatgctggtagattcatcggcgttg
ctggagcaggtcgtggtcgacgttctgcgctccggttttcagagtgcagggcagcgttgc
tccgctttgcgaattctgctggtgcaggaggatgtggcgccagcgctgatcgaactgctg
cgaggtgctatggatgaactgattatcggagatccggccgatctggcgactgatgtggga
ccggtcatcgatgaaaacgcgctggcgtcactgtatgaacacattgattacctggaaggt
aatgcccggttgctcaaatgctgtgagctttcagatagcttgtcagacaccttgtacttc
gcacctcgcttgtatgagatcagccgtatagaacagctttcccgtgaagtgtttgggccg
atcgtccatctgctgcgcttcagggcctctgatctggatcgtgtcatcgatcagattaat
gcaacagggtatggtctgacattcggcattcatagccgaatcagcagtcgcgcccagact
attgcgtcccgcattaacgccggtaatgtgtatgttaaccgcaatatgatcggtgctgtg
gtgggtgtacaaccctttggtggcagtggcttgtccggcactggtcctaaagctggcggc
cccctgtatctgacccgtttcaccaatgaacagagcattagcattgataccactgctgca
ggcggcaacgcctcattgtttgcgctttcggatgatcactga

DBGET integrated database retrieval system