KEGG   Pseudoalteromonas spongiae: PSPO_a1921Help
Entry
PSPO_a1921        CDS       T05098                                 

Gene name
truC
Definition
(GenBank) tRNA pseudouridine65 synthase
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
pspo  Pseudoalteromonas spongiae
Brite
KEGG Orthology (KO) [BR:pspo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pspo03016]
    PSPO_a1921 (truC)
Enzymes [BR:pspo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     PSPO_a1921 (truC)
Transfer RNA biogenesis [BR:pspo03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    PSPO_a1921 (truC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: ATC98943
UniProt: A0A290T3X4
Position
I:complement(1814335..1815087)
Genome map
AA seq 250 aa AA seqDB search
MFGELPILYRDEHFIAIDKPSGLLVHRSFLDKRETHFAMQMLRDQIDQHVFPLHRLDRPT
SGVLLFGLSSDVARTASSLFSEHKISKRYLALTRGFAPESLHVDHALKYKHDKIADKFAD
KEKPAQEAQTDFKCLHQAVINKPLGKFPTVRYSLVECLPKTGRKHQIRRHLNHINHPILN
DANYGDNKQNHFFQQEFGLNRLMLFAKELTFEHPFSKQTIHIEASIGEPELELFKRLGWP
GEEKDYRLLK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtttggtgaattaccgattttatatcgtgatgaacactttattgcgattgataaaccg
tcgggtttattagtgcatcgctcttttttagataaacgtgaaactcattttgcgatgcag
atgctacgcgaccaaattgatcaacatgtgtttccgcttcatcggttagacaggcctact
tctggtgtgttgttatttggtttaagtagtgatgtagcgcgtaccgcaagttcactcttt
tcagagcataagatcagcaagcggtacttagccctaacacgtgggtttgcgccagagtcg
ttacatgtggatcatgcactcaaatataaacacgataagattgccgataagtttgccgat
aaagaaaaaccagcgcaagaagcacaaactgactttaagtgtttacaccaagctgtgatc
aataaaccacttggtaagtttccaacggtgcgttattcactggtagagtgtttaccaaaa
actggccgtaagcaccaaattaggcgccatttaaaccatattaatcatcctattttgaat
gatgcaaattatggtgataacaagcagaatcattttttccagcaagagtttggtttaaat
cgcttgatgctatttgctaaagaactcacttttgagcatccctttagtaagcagacaatt
catattgaggcctcgataggcgagccggagcttgaactatttaagcgcttaggctggcca
ggtgaagaaaaagattatcggttgctaaaataa

DBGET integrated database retrieval system