KEGG   Pseudoalteromonas spongiae: PSPO_a2129Help
Entry
PSPO_a2129        CDS       T05098                                 

Gene name
phhA
Definition
(GenBank) phenylalanine-4-hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
pspo  Pseudoalteromonas spongiae
Pathway
pspo00360  Phenylalanine metabolism
pspo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pspo00790  Folate biosynthesis
pspo01100  Metabolic pathways
pspo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pspo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    PSPO_a2129 (phhA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PSPO_a2129 (phhA)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PSPO_a2129 (phhA)
Enzymes [BR:pspo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     PSPO_a2129 (phhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: ATC99121
UniProt: A0A290T6B0
Position
I:complement(2025619..2026416)
Genome map
AA seq 265 aa AA seqDB search
MGKSSSYISKQPDDNGFINWSDEENQIWSELIARQLECIKNKACDEYMHGLDKLNLPLDR
IPQLEEVSKVLRESTGWECAPVPALIDFDEFFRLLANKKFPVATFIRSREEFDYLQEPDI
FHEIFGHCAMLTHPAFAEFTHKYGQLGLAAEKKDRVYLARLYWFTVEFGLMQTKDGLRIY
GGGILSSPGETQYVYSDVPQIKPLEPLDVLRTPYRIDIMQPLYYTINAIEDLFDISQLDI
MSLVEKAKELGLHEPLFPPKQKKAS
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaaagtagtagttatatttctaaacagccagatgataatgggtttatcaattgg
tctgatgaagaaaatcaaatttggtcagaactgatcgcacgtcaattagaatgtataaaa
aataaagcgtgtgatgagtatatgcatggcttagataagctaaacctgccgcttgaccgt
attccacaattagaagaagtgagtaaagtgctgcgcgaatcgaccggttgggaatgcgcg
ccagttcctgcattgattgattttgatgagtttttccgtttgctggcaaataaaaaattc
ccggtagcgacctttattcgctcacgtgaagagtttgattatttgcaagagccagatatc
tttcacgagatctttggtcactgcgctatgttaacgcatcccgcatttgcagagtttaca
cataaatatggtcagcttggcttagctgctgagaaaaaagaccgcgtatatttagcgcgt
ttatattggtttaccgttgagtttggtttaatgcaaactaaagatggtctacgcatttat
ggcggtggtattttatcaagcccaggcgaaacccagtatgtgtattcagatgtgccacaa
atcaagccgcttgaaccactcgatgtgttacgcacgccgtaccgtatcgacattatgcaa
cctttgtattacaccattaatgcaattgaagatttatttgatatttcacagctcgatatt
atgtcgcttgtagaaaaagcaaaagagctagggctccacgagccactatttccacctaaa
caaaagaaagcaagttag

DBGET integrated database retrieval system