KEGG   Pseudoalteromonas spongiae: PSPO_a2229Help
Entry
PSPO_a2229        CDS       T05098                                 

Gene name
oadA
Definition
(GenBank) oxaloacetate decarboxylase, alpha subunit
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
pspo  Pseudoalteromonas spongiae
Pathway
pspo00620  Pyruvate metabolism
pspo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pspo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PSPO_a2229 (oadA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pspo02000]
    PSPO_a2229 (oadA)
Enzymes [BR:pspo01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     PSPO_a2229 (oadA)
Transporters [BR:pspo02000]
 Other transporters
  Primary active transporters [TC:3]
   PSPO_a2229 (oadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 PTS_EIIA_1
Motif
Other DBs
NCBI-ProteinID: ATC99204
UniProt: A0A290T4J0
Position
I:complement(2135294..2137084)
Genome map
AA seq 596 aa AA seqDB search
MSQLKLTELVLRDAHQSLLATRLRLEDMLPIAEKLDKVGYWSMESWGGATFDACIRYLGE
DPWHRIRALKAAMPNTKQQMLLRGQNLLGYRHYADDVVERFVERAHKNGVDVFRIFDAMN
DVRNLETAIKSAVKVGAHAQGTISYTVSPVHNLQMWLDQAKQLEDLGVHSICIKDMAGLL
NPYDAEKLITGLKETVAVPIAMQCHATTGLSTATYQKAIDAGIDMLDTAISSMSMTYGHS
ATETIVSIVENTDRATGLDMNLLEEIAAYFRDVRKKYAKFEGSLKGVDGRILLAQVPGGM
LTNMENQLKEQGADDKLDDVLLEIPKVREDLGFLPLVTPTSQIVGTQAVLNVLTGERYKS
ITKETAGVLKGEYGSTPAPVNKELQERVLDGAEPITCRPADQIEPELSKLEQELDEIAQK
DKLDLADDVIDDVLTYALFPQIGLKYLKNRNNPEAFEPAPSNEPLPTEQVPAPKPSGKTE
HYSISVDGKVYAVSVAPSGELTNIQPAPSASSQHTDVLPQSTSVDAAETLNSPLSGNIFK
VNAKPGQQVAKGDVVIIMEAMKMETEVRAAKDGTIAEIFVSEGDSVATGEPLLSLA
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaactaaaattaacagaattagtactgcgcgatgcacaccagtcattactcgcg
acccgtttacgcttagaagatatgttaccaattgctgaaaagctagataaagtaggttat
tggtcaatggaatcgtggggcggggcgacgtttgacgcatgtattcgttatttaggtgaa
gatccttggcaccgcattcgtgcgttaaaagcggcaatgccgaataccaaacagcaaatg
ttgcttcgtggtcaaaacttattaggttaccgtcattatgctgatgacgtggtagaacgt
tttgttgaacgagcacataaaaacggtgtcgacgtttttcgtatttttgatgcaatgaat
gatgtgcgtaatttagaaactgctattaagtcggcggtaaaagtaggggcacatgcacaa
ggtacaatctcatacacagttagccctgtgcacaatctgcaaatgtggcttgatcaagca
aaacaattggaagatttaggcgttcactctatttgtattaaagatatggcgggtctgctt
aatccgtacgatgcagaaaaattaattaccggtttaaaagagaccgttgctgtaccaatc
gcaatgcaatgtcacgcaactaccggactaagcaccgcaacgtatcaaaaggcgattgat
gctggtattgatatgcttgatacagcaatctcaagtatgagtatgacctatggtcacagc
gctactgaaacgattgtatcaatcgtagagaatactgaccgtgcaaccggccttgatatg
aacttactggaagaaattgctgcgtactttagagacgtacgtaagaaatacgctaagttc
gaaggcagtctaaaaggcgttgatggccgtattttgttagcgcaagtgccaggtggcatg
ttaacaaatatggaaaatcagcttaaagaacaaggcgctgacgataaattagacgatgta
ttgttggaaattcctaaagtgcgtgaagatctaggctttttaccgcttgttacacctaca
tcgcaaattgttggtacccaagcagtgttaaatgttttaaccggtgaacgttacaagtca
atcaccaaagagaccgctggtgtgcttaaaggcgaatacggttctacccctgcgcccgta
aataaagaattgcaagagcgtgtacttgatggtgcagagccaatcacgtgtcgtcctgca
gatcaaattgaaccagaactcagtaaattagagcaagagcttgatgaaattgcacaaaaa
gataaattagatttagccgatgatgtgattgatgatgtattaacgtatgcattattcccg
caaataggtttgaaatatcttaaaaacagaaataatcctgaggcgtttgagccagcacca
agtaatgagccactgcctactgagcaggtacccgcgccaaaaccaagtggcaaaacagag
cattacagcatcagtgttgatggcaaagtgtatgcagtaagtgttgccccaagcggcgaa
cttaccaatattcagccagcaccaagtgcatcgagtcaacacacagatgtattaccgcaa
tcaacctctgttgatgctgccgaaacgctaaattctccgctgtctggcaatatttttaaa
gtgaatgccaaacctggtcaacaagtggcgaaaggcgacgttgtgatcattatggaagcg
atgaaaatggaaactgaagttcgtgcagctaaagatggcactatcgcagaaatatttgta
tctgaaggggattcagttgcaactggcgaacctttattgtcgctagcgtaa

DBGET integrated database retrieval system