KEGG   Pandoraea sputorum: NA29_04855Help
Entry
NA29_04855        CDS       T03554                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pspu  Pandoraea sputorum
Pathway
pspu00071  Fatty acid degradation
pspu00072  Synthesis and degradation of ketone bodies
pspu00280  Valine, leucine and isoleucine degradation
pspu00310  Lysine degradation
pspu00362  Benzoate degradation
pspu00380  Tryptophan metabolism
pspu00620  Pyruvate metabolism
pspu00630  Glyoxylate and dicarboxylate metabolism
pspu00640  Propanoate metabolism
pspu00650  Butanoate metabolism
pspu00900  Terpenoid backbone biosynthesis
pspu01100  Metabolic pathways
pspu01110  Biosynthesis of secondary metabolites
pspu01120  Microbial metabolism in diverse environments
pspu01130  Biosynthesis of antibiotics
pspu01200  Carbon metabolism
pspu01212  Fatty acid metabolism
pspu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pspu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NA29_04855
   00630 Glyoxylate and dicarboxylate metabolism
    NA29_04855
   00640 Propanoate metabolism
    NA29_04855
   00650 Butanoate metabolism
    NA29_04855
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NA29_04855
   00072 Synthesis and degradation of ketone bodies
    NA29_04855
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NA29_04855
   00310 Lysine degradation
    NA29_04855
   00380 Tryptophan metabolism
    NA29_04855
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NA29_04855
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NA29_04855
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NA29_04855
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pspu04147]
    NA29_04855
Enzymes [BR:pspu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     NA29_04855
Exosome [BR:pspu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NA29_04855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AJC15548
UniProt: A0A239S7Z5
Position
complement(128076..129260)
Genome map
AA seq 394 aa AA seqDB search
MNTDIVIVDAVRTAIGEFGGALREHPPADLGSAVVRALLARTGVSGDTIDQVIFGNVHQT
SAGDMYLARRVALGGGVAPRAGALTVNRLCGSGLESVLLAAQFIDSGEAETAIGGGAETM
SLAPYMLPAHRFGSRPGDVVAVDTLMGGLTDPMIGVHMGELGERVAASRDIGRAEQDAIA
LASHQRAAHAIEAGYFDAQVVPLDIGTARKPATFSRDERVRATPCADDFVHLKPVFRRDG
GTITAANASGISDGACAVLLTSTRNAQTRRLRPLARLVAHARVGVPPEEMGFGPVVATRE
VLKRADLHIGQIGVIEVNEAFASVVGAFLKELSLDASRVNPNGGAIALGHPVGATGAILV
TKAAYELQRTGARYALVTTCIGGGQGMAVILERV
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaataccgacatcgtcatcgtcgatgccgttcgtacggccatcggcgaattcggcggg
gcgttgcgcgagcatccgccagccgatctgggcagcgctgtcgtgcgcgcgctactggcc
cgtaccggtgtctcgggcgacaccatcgatcaggtcatcttcgggaacgttcatcagacg
tccgcaggcgatatgtacctcgcgcggcgtgtcgcactcggtggcggcgtcgcacctcgc
gccggtgcgctgaccgtcaatcgcctctgcggctcgggactcgaatccgtcctccttgcg
gcacagttcatcgattcgggggaagcagagacggctatcggtggcggtgccgagacgatg
agtctcgcgccctacatgctgcccgcccaccgcttcggctcgcgtcccggcgacgtcgtt
gccgtcgatacgttgatgggcggtctcaccgatccgatgatcggcgtccacatgggggag
ttgggcgaacgcgtggccgcgtcgcgcgatatcggccgcgccgaacaggatgccattgca
cttgcttcgcatcaacgcgccgcgcacgccatcgaggcgggctacttcgacgcgcaggtc
gtcccactcgacattggcaccgcacgcaagcccgccactttctcgcgagacgagcgtgta
agagccacgccctgcgcagacgatttcgtgcatctcaagccggtgtttcgccgtgacggc
ggcacgatcacggcggcgaatgcatcgggcatcagcgacggcgcgtgcgccgtgctgctg
acgtccacccgcaacgctcagacacggaggctgcgaccgctcgcgcgtctcgtcgctcat
gcacgggtcggtgtgccacctgaggagatggggttcggtccggtcgtcgcgacgcgcgag
gtcctcaagcgggcagatctgcatatcgggcagataggcgtcatcgaagtgaatgaggcg
tttgcgtccgtcgtcggcgcatttctcaaggagctgtcgctcgacgcgtcgcgcgtcaat
ccgaacggcggcgcgattgcgctgggccatcccgtcggcgcgaccggtgcaatcctcgtg
actaaggcggcctacgaattgcagcgcaccggcgcacgctacgcgctcgtcacgacgtgc
attggcggcgggcaggggatggcggtgattttggagcgggtgtaa

DBGET integrated database retrieval system