KEGG   Pandoraea sputorum: NA29_06790Help
Entry
NA29_06790        CDS       T03554                                 

Definition
(GenBank) 2,3-diaminopropionate biosynthesis protein SbnB
  KO
K21721  N-[(2S)-2-amino-2-carboxyethyl]-L-glutamate dehydrogenase [EC:1.5.1.51]
Organism
pspu  Pandoraea sputorum
Pathway
pspu00998  Biosynthesis of secondary metabolites - other antibiotics
pspu00999  Biosynthesis of secondary metabolites - unclassified
pspu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pspu00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of secondary metabolites - other antibiotics
    NA29_06790
   00999 Biosynthesis of secondary metabolites - unclassified
    NA29_06790
Enzymes [BR:pspu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.51  N-[(2S)-2-amino-2-carboxyethyl]-L-glutamate dehydrogenase
     NA29_06790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OCD_Mu_crystall Shikimate_DH AlaDh_PNT_C F420_oxidored 2-Hacid_dh_C NmrA
Motif
Other DBs
NCBI-ProteinID: AJC15846
UniProt: A0A239S7X8
Position
548752..549786
Genome map
AA seq 344 aa AA seqDB search
MNARPIPQFRVFTGEQIDTAVRHGKHAILDTVEAAYRAHHAGHTVNPESQFLRFPDAQRN
RIIALPAHIRGRGEGRESVTGIKWISSFPENIERGMPRASAVLILNDAVTGYPMACMEAS
IISAARTAASAISALRCLAHDATACPRRVALIGAGVIARHVAECLPLAELSIGEVMVHDL
NIRYAESLASRIETQIGLNARVEASLENAIRESDVIVLATTAVSPHIEDPEWFAHCPIVL
HLSLRDLAPSIVMAAHNVVDDIDHCLRASTSLHLTEIATGHRRFVTTSLPHLLSGGEPPM
RDRPIVFSPFGLGILDIAVGRWVYECLAAEQAPIPRFFFDLHRA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgcgccccattccacagttccgcgtgttcactggcgagcagatcgacacggcc
gttcgccacggcaagcacgccattctcgataccgtcgaagcggcatatcgcgcgcatcac
gcgggccataccgtgaatccggaaagccagtttctccggtttcctgacgcacagcgcaat
cgcatcatcgcgttgcccgcgcacatccgcggacgtggcgaaggccgcgagagtgtgacc
ggtatcaaatggatttcgagtttcccggaaaacatcgagcgtggcatgccgagggcgtcc
gcggtgctgattctcaacgatgcggtgacggggtacccgatggcctgcatggaggcgagc
atcatcagcgcggcacgcacggcggcgagcgcgatcagcgcgcttcgatgtctcgcgcac
gacgccaccgcttgtcctcggcgtgtggcgctcatcggggcgggggtgattgcacgccat
gtcgccgagtgtctgccgctagcggaactgagcattggcgaggtcatggtccatgacctg
aacatccgatatgccgagtcgcttgcaagccgaatcgaaacgcaaattgggttgaacgcc
cgcgtcgaagcgtcgctggaaaacgcgatacgcgaatcggacgtgatcgtattggcgacc
acggcggtgtccccgcatattgaagatcccgaatggtttgcgcactgtccgatcgtgttg
catctatcgttgcgagatctcgcaccatcgattgtcatggcggcgcacaacgtggtcgac
gatatcgaccattgcttgcgtgcctcgacgtcgcttcatctcaccgaaatcgcgacgggc
catcgacgcttcgtcacgacatcgctgccgcacttgctgagcggcggtgagccgccgatg
cgcgatcggcccatcgttttttcccctttcggacttggcattctcgacatcgccgtcggt
cgctgggtctacgagtgcctggctgccgagcaggcgcccatcccccgatttttctttgac
ttgcaccgcgcatga

DBGET integrated database retrieval system