KEGG   Pandoraea sputorum: NA29_11455Help
Entry
NA29_11455        CDS       T03554                                 

Definition
(GenBank) sugar dehydrogenase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
pspu  Pandoraea sputorum
Pathway
pspu00030  Pentose phosphate pathway
pspu01100  Metabolic pathways
pspu01120  Microbial metabolism in diverse environments
pspu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pspu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NA29_11455
Enzymes [BR:pspu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     NA29_11455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR DUF1776 Epimerase
Motif
Other DBs
NCBI-ProteinID: AJC16489
UniProt: A0A239SD56
Position
1614409..1615176
Genome map
AA seq 255 aa AA seqDB search
MRMKDTVVLVTGSAQGIGRAIAIRLAQEGARIVVEDRQDNAMAGQTLDSVRAAGSDGCVI
AGDVGSVENDRAIIEQAVAKMGRLDVLVNNAGVERRAPFLDVTEADYDLVMNVNLKGAFF
LTQAFVKHLRDTQRGGRIVNVSSVHEELPFPHFASYCASKGGMKMMMRNLAIELAPLGIT
VNNVAPGAVGTPINQQLLANKAQLEALVANIPLGRLANPSEVANAVLFLASPEASYVTGT
TLFVDGGLLWNYAEQ
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatgaaggacacggtggtacttgtcaccggcagcgctcaggggatcggacgcgcc
atcgcgatccgactcgcccaggaaggggcgcgcatcgtggtggaagaccggcaggacaac
gcgatggccgggcagacgctcgactcggttcgcgccgccgggagcgacggctgcgtgatc
gcgggagatgtcgggagcgtggagaacgatcgcgccatcatcgagcaggccgtagccaaa
atgggacgccttgatgttttggtcaacaacgcaggtgtcgaacgccgtgccccatttctc
gatgtgacggaagccgattacgacctcgtcatgaacgtcaatctgaaaggggcgttcttt
cttacgcaagcctttgtgaagcacctgcgcgatacgcagcgcggcggacgcatcgtgaac
gtcagctcggtgcacgaagagctgccatttcctcacttcgcgagctattgcgcgagcaag
ggcggcatgaagatgatgatgcgcaatctcgccatcgaactggcgccgctcggtatcacg
gtgaacaatgtcgcgcccggtgccgtgggcacccctatcaatcagcaattgctcgcgaac
aaggcgcagctcgaagcgctcgtcgcgaacattccgctcggccgcctcgcgaatcccagc
gaagtggcgaatgccgtgctcttcctcgcttcgcccgaagccagctatgtgacgggcacg
acgctgttcgtcgacggcggcttgctctggaactacgcggagcaataa

DBGET integrated database retrieval system