KEGG   Pandoraea sputorum: NA29_13960Help
Entry
NA29_13960        CDS       T03554                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pspu  Pandoraea sputorum
Pathway
pspu00020  Citrate cycle (TCA cycle)
pspu00310  Lysine degradation
pspu00380  Tryptophan metabolism
pspu01100  Metabolic pathways
pspu01110  Biosynthesis of secondary metabolites
pspu01120  Microbial metabolism in diverse environments
pspu01130  Biosynthesis of antibiotics
pspu01200  Carbon metabolism
Module
pspu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pspu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pspu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NA29_13960
  09105 Amino acid metabolism
   00310 Lysine degradation
    NA29_13960
   00380 Tryptophan metabolism
    NA29_13960
Enzymes [BR:pspu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     NA29_13960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_3
Motif
Other DBs
NCBI-ProteinID: AJC16833
UniProt: A0A239SFU0
Position
2189649..2190917
Genome map
AA seq 422 aa AA seqDB search
MAIVEVKVPQFSESVSEGTLLDWKKKVGEAFAQDETIIEVETDKVVLEVPAPAAGVLVEV
TANAGDTVTSEQIIAKIDTEAKAGAAAPVAAKPAEAAAPAAAAAPAAAPAAGGASGNIAS
PAAAKVLAEKNLSAGDVAGSGRDGRVTKGDALAAGAKPAAAAASSIPAPAQRAALPSVSA
PAGRDTSLEGRPEQRVPMSRLRARIAERLLQSQQTNAILTTFNEVDMKPVMDLRNKYKDK
FEKEHGVKLGFMSFFVKAAVHALKKYPAVNASIDGNDIVYHGYFDIGIAVGSPRGLVVPI
LRNADQMSLADIEKKIAEYGKKAADGKLSIEEMTGGTFSISNGGVFGSMLSTPIINPPQS
AILGVHATKERAVVVNGEIVIRPMNYLAMSYDHRIIDGREAVLSLVAMKEALEDPARLLL
DL
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggccattgttgaagtcaaagtcccccagttttccgagtcggtttccgaaggcacgctg
ctcgactggaagaagaaagtcggcgaagcattcgctcaggacgaaaccatcattgaagtc
gagaccgacaaggtcgtgctcgaagtgccggcacccgctgctggcgtgctcgtcgaagtg
accgccaacgctggcgacaccgtgacgtccgagcagatcatcgcgaagatcgacaccgaa
gccaaggctggcgctgccgccccggtcgctgccaagccggcagaagccgccgcgcctgcc
gccgctgctgcaccggccgctgcccccgcagccggtggtgcttcgggcaacatcgccagc
ccggccgctgccaaggtgctggccgagaagaatctgtcggccggtgacgtcgccggttcg
ggccgcgatggccgcgtgaccaagggcgacgctctggctgctggcgccaagccggccgct
gctgccgcttcgtcgatcccggcaccggcacaacgtgctgcactgccgtcggtgtccgca
ccggctggccgcgacacgtcgctggaaggtcgtccggaacagcgcgtgccgatgtcgcgt
ctgcgcgcccgtatcgccgagcgcctgctgcaatcgcaacagaccaacgccattctgacc
acgttcaacgaagtggacatgaagccggtgatggacctgcgcaacaagtacaaggacaag
ttcgagaaggaacacggcgtgaagctgggtttcatgtcgttcttcgtcaaggccgctgtc
cacgcgctcaagaagtacccggccgtgaacgcttcgatcgacggtaacgacatcgtctac
cacggctacttcgacatcggtatcgctgtcggctcgccgcgtggtctggtggtgccgatt
ctgcgcaatgccgaccagatgagcctggccgacatcgagaagaagatcgccgaatacggc
aagaaggctgccgacggcaagctgtcgatcgaagaaatgactggcggtacgttctcgatc
tcgaacggcggtgtgttcggctcgatgctgtcgaccccgatcatcaacccgccgcagtcg
gccattctgggcgttcacgccacgaaggagcgcgctgtggtggtgaacggcgagatcgtc
attcgtccgatgaactatctggccatgagctacgaccaccgtatcatcgacggtcgcgaa
gccgtgctgagcctcgtcgccatgaaggaagcgctggaagatccggcccgcctgctgctc
gacctgtaa

DBGET integrated database retrieval system