KEGG   Pandoraea sputorum: NA29_14500Help
Entry
NA29_14500        CDS       T03554                                 

Definition
(GenBank) long-chain fatty acid--CoA ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
pspu  Pandoraea sputorum
Pathway
pspu00061  Fatty acid biosynthesis
pspu00071  Fatty acid degradation
pspu01100  Metabolic pathways
pspu01212  Fatty acid metabolism
pspu02024  Quorum sensing
Module
pspu_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:pspu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    NA29_14500
   00071 Fatty acid degradation
    NA29_14500
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    NA29_14500
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pspu01004]
    NA29_14500
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pspu04147]
    NA29_14500
Enzymes [BR:pspu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     NA29_14500
Lipid biosynthesis proteins [BR:pspu01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   NA29_14500
Exosome [BR:pspu04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   NA29_14500
  Exosomal proteins of breast cancer cells
   NA29_14500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C AMP-binding_C_2
Motif
Other DBs
NCBI-ProteinID: AJC16906
Position
complement(2321161..2322903)
Genome map
AA seq 580 aa AA seqDB search
MQKTSTETTMDQAVHQERVWLSAYPPGVPADIDVNRYASLVQAFDEWIEKYRDRIAFVSL
GSEITYAEVSRQAHAFAAWLQAQGVKQGERVALMMPNCFQYPICLFGTLIAGAVVVNVNP
LYTARELKHQLQDSGAQTIVVFENFAKTLEEALPDTEVRNILVTQIGDLLQPGANVKGRA
VNFLMRHIAKQVPPYRLPQAVALRQALASGARLKATPVPLVREDLAFLQYTGGTTGVAKG
AMLSHGNVLANLLQTEAWAADQLDGDIEVNLSLLPMYHILSLTLNCLVFMSLGGRNILIA
NPRDVKKVVYIIRNETFTGVTGVNTLFNGLLENPDFRARDFSKLKLSLAGGMATQRAIAE
RWKQVTGKPIIEGYGLTECSPIVTMNPVDIAHMDAVDFSGSIGLPAPSTDVRFKRDDGTW
APLGEPGELCVRGPQVMRGYWNRPEETAKTFDADGWLMTGDIGVMDERGYVRLIDRKKDM
ILVSGFNVYPNEIEDVVMLHPGVREAAVVGVPDPVAGERVKLVVIAKDPTLTIEAMAAHC
RKHLTAYKVPRIIEFRQGELPKSTVGKILRRELRDPVSGR
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaaacttcaacggagacaacgatggatcaagctgttcatcaggaacgcgtgtgg
ctcagtgcctaccctcccggggtacctgccgacatcgacgtcaatcgctatgcatcgctc
gtgcaggcgttcgacgaatggatcgagaagtaccgcgaccgcatcgctttcgtgagtctc
ggcagtgagatcacgtatgccgaggtgtcccgtcaggctcatgccttcgctgcgtggctg
caagcccagggcgtgaagcaaggcgagcgcgtcgcgctcatgatgcctaactgctttcag
tatccgatctgcctgttcggcacgctcattgccggtgctgtggtcgtcaacgtcaacccg
ttgtacaccgcgcgcgaactgaagcaccagttgcaggacagcggtgcgcagaccatcgtc
gtcttcgagaacttcgccaaaacactggaggaagcgctacccgacaccgaggtgcgcaac
atactcgtgacgcagatcggcgatttgctccagccgggagcgaacgtcaaagggcgtgcc
gtcaacttcctcatgcgacacatcgccaaacaagtgccgccgtatcgcttgccgcaggcg
gtggcgcttcgtcaggcgctcgcgagcggcgcgaggctgaaggccacgccggtgcctctc
gtgcgcgaagacctcgcctttctccaatacaccggtgggacaacgggcgtcgccaagggc
gccatgctctctcacggcaacgtgctggccaatctgctgcaaacggaggcgtgggcggcc
gatcagctcgacggcgacatcgaagtcaatctgtcgttgctgccgatgtatcacatcctc
tcgctcacattgaactgtctggtgttcatgagcctgggcggacgcaacatcctgattgcg
aatccacgcgatgtgaaaaaggtcgtctacatcattcgcaacgaaacgttcaccggcgtg
accggcgtcaacacgttgttcaacgggttgctcgagaaccccgacttccgtgcacgcgac
ttctccaaactgaaactgtcgctcgctggcggcatggcaacgcaacgcgcgatagccgag
cgatggaagcaggtcacgggcaagccgatcatcgaaggctacggcctcaccgaatgctcc
cccatcgtcacgatgaatcccgtggacatcgcgcacatggacgcggtcgatttctccggc
tccatcggcctgcccgcgccgtcgaccgatgttcgctttaagcgcgacgacggtacgtgg
gcacccctcggcgagccgggcgagttgtgcgtgcgcggaccgcaggtcatgcgcggctac
tggaatcgccccgaagagacggccaaaacgttcgacgcagacggctggctgatgaccggc
gacatcggtgtcatggacgaacgcggttatgtgaggctgatcgaccgcaagaaggacatg
attctcgtgtcgggtttcaacgtttatccgaacgagatcgaggacgtcgtgatgctccac
cccggcgtgcgcgaggcggccgtcgtcggcgtgcccgatccggtggctggcgagcgcgtg
aagctcgtagtcatcgccaaagacccgacgctcaccatcgaagccatggccgcgcactgc
cgcaagcatctgaccgcatacaaggtgccgcgcatcatcgaattccgtcagggcgaacta
cccaagtcgacggtgggcaaaatcctgcggcgagagctgcgcgatccggtctcagggagg
tag

DBGET integrated database retrieval system