KEGG   Pandoraea sputorum: NA29_24505Help
Entry
NA29_24505        CDS       T03554                                 

Definition
(GenBank) acyltransferase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
pspu  Pandoraea sputorum
Brite
KEGG Orthology (KO) [BR:pspu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    NA29_24505
Enzymes [BR:pspu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     NA29_24505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: AJC19253
UniProt: A0A239SRQ9
Position
4644974..4645831
Genome map
AA seq 285 aa AA seqDB search
MTSPDTKSTAQPAPTGAPVRVAAAQMVSAPDVERNLREAARLVAEAAHAGAELVLLPEYF
CYMGQRDTDKLALRETPGSGPIQDFLAETARRYGVWLIGGTLPLAAPEPERVLNTTLVFA
PDGAPAARYDKIHLFNFVKGEEAYDEARTIRPGDAVRTFEAPFGRVGLSVCYDLRFPELY
RAMGDCTLMVVPAAFTYTTGRAHWELLLRARAVENQCYVLASAQGGHHENGRRTWGHSML
IDPWGEIVAQREAEGAGVVVGEIDPARLVGVRQSLPAWRHRVLQG
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgacgagtcccgatacgaagtcaaccgcccagcccgccccgaccggcgcgcccgttcgc
gtggctgccgcgcaaatggtgagtgcgcccgacgtcgagcggaacctgcgtgaagccgcc
cgtctggtggccgaagcggcgcacgccggggccgagctggtgctgctgccggagtatttc
tgctacatgggccagcgcgacaccgacaagctcgccctgcgcgaaacgccgggcagtggt
ccgattcaggactttctggcggagacggcgcgccgctacggcgtctggctgatcggcggc
acgctgccgctggccgcgccggagcccgaacgcgtgctcaacacgacgctggtcttcgcg
ccggacggcgcacccgccgcacgctacgacaagatccacctgttcaacttcgtcaaaggt
gaggaagcctatgacgaagcgcgcaccattcgtcccggcgacgccgtacgcacgtttgaa
gcgccgttcgggcgcgtgggcctgtcggtatgctacgacctgcgttttcccgagttgtac
cgggcgatgggcgactgtacgctcatggtcgtacccgccgcctttacctacaccacgggc
cgcgcgcactgggaattgctgctgcgcgcgcgggccgtcgagaaccagtgctacgtgctg
gcgtccgcgcagggcgggcaccacgagaacgggcggcgtacctgggggcattccatgctg
atcgacccgtggggcgagatcgtcgctcagcgcgaagcggaaggcgctggcgtggtcgtg
ggcgagatcgacccggcccggctggtcggcgttcgccagagtctgcccgcctggcgtcac
cgcgtgctgcaaggctga

DBGET integrated database retrieval system