KEGG   Paraburkholderia sprentiae: BJG93_03185Help
Entry
BJG93_03185       CDS       T04610                                 

Definition
(GenBank) adenylosuccinate synthase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
pspw  Paraburkholderia sprentiae
Pathway
pspw00230  Purine metabolism
pspw00250  Alanine, aspartate and glutamate metabolism
pspw01100  Metabolic pathways
Module
pspw_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:pspw00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BJG93_03185
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BJG93_03185
Enzymes [BR:pspw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     BJG93_03185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: APA84509
UniProt: A0A1I9YDX6
Position
1:710285..711631
Genome map
AA seq 448 aa AA seqDB search
MSASAVNVNPGRNVVVVGTQWGDEGKGKIVDWLTDHAQGVVRFQGGHNAGHTLIIGGKKT
ILRLIPSGIMHPGVACYIGNGVVLSPEALFKEIGELEAAGIDVQKRLFISEATTLILPYH
IAIDQGREARRGASKIGTTGRGIGPAYEDKVARRGLRVQDLFDAPAFAERLRENLDYHNF
VLTQYLGAAAVDFQQTLDTMSSYADRLKPMVTDVSRRLYDVNANGGNLLFEGAQGTLLDI
DHGTYPFVTSSNCVAGAATAGAGVGPQKLNYILGITKAYCTRVGSGPFPSELYDADNASR
QEPIGLELATVGKEFGSVTGRPRRTGWLDVAALRRSIQINGVTGLCMTKLDVLDGLDEVK
LCVGYTVDGQNVDLLPRGATEVARCMPVYETFTGWKESTVGIKEWDELPANARAYLTRVQ
EVAGIPIDMVSTGPDRDETILLRHPFKV
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccagcgcagtgaatgtgaaccccgggcgcaacgtcgtcgtcgtgggtacccaa
tggggtgatgagggcaagggcaagatcgtcgactggctgacggaccacgctcaaggcgtc
gttcgcttccagggcggtcacaatgccggtcacacgcttatcatcggcggcaagaaaacc
atcttgcgtctgattccctcgggcatcatgcatcccggcgtcgcgtgctacatcggcaat
ggcgtcgtgttgtcgccggaagcgctgttcaaggaaatcggcgaactcgaagccgccggc
atcgacgtccagaagcgcctgttcatttccgaagccaccacgctgatcctgccgtatcac
atcgcgatcgaccagggccgcgaagcgcgccgcggcgcgagcaagatcggcacgaccggc
cgcggcatcggcccggcctatgaagacaaggtcgcgcgccgcggcctgcgcgtgcaagac
ctgttcgacgcaccagcctttgccgagcgtctgcgcgaaaacctcgactatcacaacttc
gtgctcacgcagtacctcggcgcagccgcggtcgacttccagcaaacgctcgacacgatg
tcgagctacgccgaccgcctgaagccgatggtcaccgacgtctcgcgccgtctctacgac
gtcaacgcgaacggtggcaatctgctgttcgaaggcgcgcagggcacgctgctcgacatc
gaccacggcacctatccgttcgtcacgtcgagcaactgcgtcgcgggtgccgcgacggcg
ggggcgggcgtcggtccgcagaagctgaactacatcctcggtatcacgaaggcgtactgc
acgcgggttggttcggggccgttcccgagcgagctgtacgatgcagacaacgcgtcgcgc
caggagccgatcggcctcgaactcgccaccgtcggcaaggaattcggctcggtcacgggt
cgtccgcgccgcaccggctggctcgacgtcgccgcgctgcgccgctcgattcagatcaac
ggcgtgacgggtctgtgcatgaccaagctcgacgtgctcgacggtctcgacgaagtgaag
ctgtgcgtcggctacacggtcgacggccagaacgtcgatctgctgccgcgcggcgcgacc
gaagtcgcgcgctgcatgccggtctacgaaaccttcacgggctggaaggaaagcacggtc
ggcatcaaggagtgggacgagctgcccgccaacgcacgtgcatatctcactcgtgtgcag
gaagtcgcgggcattccgatcgacatggtgtccaccggtccggatcgcgacgaaacgatt
ctgctgcgtcatccgttcaaggtctga

DBGET integrated database retrieval system