KEGG   Paraburkholderia sprentiae: BJG93_10420Help
Entry
BJG93_10420       CDS       T04610                                 

Definition
(GenBank) acyltransferase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
pspw  Paraburkholderia sprentiae
Brite
KEGG Orthology (KO) [BR:pspw00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BJG93_10420
Enzymes [BR:pspw01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     BJG93_10420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: APA87021
UniProt: A0A1I9YL38
Position
1:2353087..2353950
Genome map
AA seq 287 aa AA seqDB search
MSETHVPSSASVHASGGPAASAFRVAALQMVSTPDPDRNLADAQRLIAEAAADGAQLVLL
PEYFCFMGFKDTDKLAVREPHRDGPIQRFLADAARRHQLWVIGGTLPLNAPEASRVLNTT
LVFDPLGNEAARYDKIHLFNFEKGEESFDEARTIRPGTAVQTFEAPFGRVGLSVCYDLRF
PELYRRMGDCALIVVPSAFTYTTGRAHWELLLRTRAIENQCYVLAAAQGGKHENGRRTWG
HSMLIDPWGEIVAVRDEGAGVVAGNLERARIDEVRQSLPAWRHRVLT
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaacacacgtcccttcttctgcatccgtccatgcatccggcgggccggcggcc
agcgcgtttcgggtcgccgcgctgcagatggtcagcacgccggatcccgatcgcaatctc
gccgacgcacagcgcctgattgccgaagctgccgccgacggcgcgcaactcgtgctgctg
cccgagtatttctgcttcatgggcttcaaggacaccgacaagctcgccgtgcgcgagccg
catcgggatggcccgatccagcgctttctcgccgacgccgcgcgccgccaccagctctgg
gtgatcggcggcaccttgccgctgaacgcgcctgaggcgtcgcgcgtgctgaacacgacg
ctcgtgttcgacccgctgggcaacgaagccgcgcgctacgacaagatccatctgttcaac
ttcgaaaagggcgaagaatcgttcgacgaagcgcgcacgatccggcccggcaccgcggtg
caaactttcgaggcgccattcggccgggtcggcctgtcggtctgctacgatctgcgcttt
cccgagctgtaccggcgcatgggcgactgcgcgctgatcgtggtgccgtccgcgtttacc
tacaccaccggccgcgcgcattgggagctgctgctgcgcacccgcgcaatcgaaaatcag
tgctacgtgctagccgcggcgcaaggcggcaaacatgagaacggccgccgcacctggggc
cacagcatgctgatcgacccgtggggcgagatcgtcgcggtgcgcgacgagggcgccggc
gtggtcgcgggcaacctcgaacgcgcgcgcatcgacgaagtgcggcagagcctgccggca
tggcgtcatcgcgtgctgacctga

DBGET integrated database retrieval system