KEGG   Paraburkholderia sprentiae: BJG93_14290Help
Entry
BJG93_14290       CDS       T04610                                 

Gene name
ompR
Definition
(GenBank) two-component system response regulator OmpR
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
pspw  Paraburkholderia sprentiae
Pathway
pspw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pspw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BJG93_14290 (ompR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:pspw02022]
    BJG93_14290 (ompR)
Two-component system [BR:pspw02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   BJG93_14290 (ompR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: APA86434
UniProt: A0A1I9YJF1
Position
1:complement(3191726..3192466)
Genome map
AA seq 246 aa AA seqDB search
MNPQVLIVDDDPVVRDLLCKFLQSNGFDASVLHDGTHLQRRLERERPSVVVLDIMMPNTD
GLRALTALRAAGDDIPVIFVTARGTVADRIVGLSLGADDYLTKPFDPRELLVRIQTVLRR
RGPPTTSAPEARKRYRFGPFELDFATRALTRDDAKLPLRDSEFALLKIFVNNPYKVLSRV
LIHDLVHRDNLAFRDRSLDVPIWRLRRVIEDDPSNPCYVQTVRGQGYVFVPDANGTPFED
EAVPSA
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaatccacaggtccttatcgtcgacgacgatccggtcgttcgcgatctgctttgcaag
ttcctgcagtcgaacggcttcgacgcgtccgtgctgcatgacggcactcatttgcagcgt
cgtctcgaacgtgagcggccgtcggtcgtcgtgctcgacatcatgatgccgaacaccgac
ggcctgcgcgcgctcaccgcgttgcgcgccgccggcgacgacatcccggtgatcttcgtg
accgcgcgcggcacggtggccgaccgcatcgtcggtctgtccctcggggcggacgactac
ctgaccaagccgttcgatccgcgcgagctgctcgtgcgcatccagaccgtgctgcgccgg
cgcgggccgcccaccacgagcgcgcccgaagcgcgcaagcgctatcgcttcggtccgttc
gaactggacttcgccacgcgcgcgctgacccgcgacgacgccaagctgccgctgcgcgac
agcgaattcgcgctgctgaagatcttcgtcaacaatccgtacaaggtgctgtcgcgcgtg
ctgattcacgatctcgtgcatcgcgacaacctcgcgttccgcgaccgcagcctcgacgtg
ccgatctggcgtctgcgccgcgtgatcgaggacgacccgtcgaacccgtgctacgtgcaa
acggtgcgcggccagggctacgtgttcgtgcccgacgccaacggcacgcctttcgaggac
gaggccgtaccaagcgcatga

DBGET integrated database retrieval system