KEGG   Paraburkholderia sprentiae: BJG93_14865Help
Entry
BJG93_14865       CDS       T04610                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
pspw  Paraburkholderia sprentiae
Brite
KEGG Orthology (KO) [BR:pspw00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    BJG93_14865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: APA86533
UniProt: A0A1I9YJQ0
Position
1:3300963..3301337
Genome map
AA seq 124 aa AA seqDB search
MSQYEFSVSAQVRYLPDESDPERRQYAFAYTLTIRNTGQVPAQLIARHWIITDSDNAVQE
VKGLGVVGHQPLLKPGEHFEYTSWAVIATPVGTMRGDYFCVAEDGERFEAPVPEFVLRMP
RTLH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgagccagtatgaattcagcgtctcggcgcaggtgcgatacctgcccgacgaatcggac
ccggagcgtcgccagtatgcgtttgcctacacgctgaccatccgtaacaccggccaggtg
cccgcccagttgatcgcgcgtcactggatcatcaccgacagcgacaacgccgtgcaggaa
gtcaaaggcctgggcgtggtcggtcatcagccgctgctcaaaccgggcgagcatttcgaa
tacacgagttgggcagtgatcgcgacgccggtcggcacgatgcgcggcgattacttctgc
gtggcggaggatggcgagcgcttcgaggcgccggtgccggagttcgtgttgcgcatgccg
cggacgttgcattga

DBGET integrated database retrieval system