KEGG   Paraburkholderia sprentiae: BJG93_17140Help
Entry
BJG93_17140       CDS       T04610                                 

Definition
(GenBank) epimerase
  KO
K18981  uronate dehydrogenase [EC:1.1.1.203]
Organism
pspw  Paraburkholderia sprentiae
Pathway
pspw00053  Ascorbate and aldarate metabolism
pspw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pspw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    BJG93_17140
Enzymes [BR:pspw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.203  uronate dehydrogenase
     BJG93_17140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD NAD_binding_10 NAD_binding_4 Polysacc_synt_2 NmrA RmlD_sub_bind
Motif
Other DBs
NCBI-ProteinID: APA87263
UniProt: A0A1I9YLT0
Position
2:complement(160216..161010)
Genome map
AA seq 264 aa AA seqDB search
MKKIALSGAGGQLGSVVRAEFVARGVPLRSAAGSKVLTPLVDGEDVMNGDLRDPAVVDRL
LNGVDVLIHFAGTSVERPLPEIIENNLRGLVEVYEGARRNGVKRIVFASSNHAIGMYPVT
EHLSLDCELRPDGFYGLSKVWGEALARMYWDKHGIESVCVRIGSCLERPTEQRHLSTWFG
HKDLMHFLERCIEAEDVGFLTIWGVSANTRSWWDNSGAARLGYEPKQNAEDYAQDILSRP
NPLDELGQRYQGGSFVGIDYSRKA
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagattgccctgagtggcgccggcggccagctcggctccgtggtacgtgctgaa
ttcgtcgcgcgcggcgtgccgttgcgctcggccgccggctccaaggtgctgacgccgctc
gtcgacggcgaagacgtcatgaacggcgacctgcgcgatccggccgtcgtcgaccggttg
ctgaacggcgtggacgtgctgatccatttcgcaggcacgagcgtcgagcgtccgctgccc
gagatcatcgagaacaacctgcgcggtctcgtcgaagtctacgaaggcgcgcgccgcaac
ggcgtaaagcgcatcgtgttcgcgagctcgaaccacgcgatcggtatgtatccggtcacc
gaacatctgagcctcgactgcgaactgcgtccggacggcttctatggcctgtcgaaggtg
tggggcgaagcgctcgcgcgcatgtactgggacaagcacggcatcgaaagcgtgtgcgtg
cgcatcggcagctgcctggagcgtccgaccgagcagcgtcacctgagcacctggttcggc
cataaggacctgatgcatttcctcgagcgctgcatcgaagcggaggacgtcggcttcctg
accatctggggcgtgtcggcgaatacgcgtagctggtgggacaacagcggcgccgcgcgc
ctcggctacgagccgaagcagaacgccgaggactatgcgcaagacatcctgtcgcgcccg
aatccgctcgatgaactgggccaacgctaccagggcggcagcttcgtcggcatcgactat
tcgcgcaaggcttaa

DBGET integrated database retrieval system