KEGG   Paraburkholderia sprentiae: BJG93_23300Help
Entry
BJG93_23300       CDS       T04610                                 

Definition
(GenBank) anion permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
pspw  Paraburkholderia sprentiae
Brite
KEGG Orthology (KO) [BR:pspw00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BJG93_23300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: APA88306
UniProt: A0A1I9YQ14
Position
2:complement(1556350..1557933)
Genome map
AA seq 527 aa AA seqDB search
MPELSYPQPGTTSKGRNAGLFIFVALLIAGVVYCGVHLIDDLQPVRESSVLPYLLLGVAL
LIALGFEFVNGFHDTANAVATVIYTHSLTPNIAVVWSGAWNFLGVLTSSGAVAFGVLQLL
PVELILQVGSSAGFAMVFALLIAAIIWNLGTWSFGLPSSSSHTLIGSIIGVGLMNQIMHG
TNGTSGVDWNQALGVGKSLLFSPIVGFLLAGLLLLILKALVRVPALYAEPKGTEPPPFWI
RCLLILTCTGVSFAHGSNDGQKGMGLIMLILIGTVPTAYALNKAVTAEQSQNFVAVAHQT
VATLSRYTQGAAPSADPRADVEAFVRTRQLTPATLPALQQLAGQIGRQVGESGSMAAVPQ
GIVDNVRNNMYVASEAIRLMQKANQPQFSPDDAKVIANFRTQLDHATKFIPPWVKVAVAI
ALGLGTMVGWKRIVVTVGEKIGKQHLTYGQGAAAEVVAMVTIGAADVYGLPVSTTHVLSS
GVAGTMAANGSGLQWATVRSLILAWVLTLPASIALAGGLYWVFRSVF
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgccggaactttcgtatccgcaaccaggcaccaccagcaaagggcgtaatgcgggcctg
ttcattttcgtcgccctgctcatcgccggcgtcgtgtactgcggcgtgcatctgatcgac
gatctgcagccggtacgtgaaagctcggtgctgccctatctgttgctcggtgtcgcactg
ctgatcgcgctcggtttcgagttcgtcaacggctttcacgatacggccaacgcggtggcc
acggttatctatacccactcgctgacgccgaatatcgctgtcgtctggtccggcgcgtgg
aattttctcggcgtgctgacgtcgagtggggccgtcgccttcggggtgctgcaactgctg
cccgtcgagctgatcctgcaggttggcagcagcgccggcttcgcgatggtgttcgcgctg
ctgatcgccgcgatcatctggaatctcggcacgtggtctttcggcctgccgtcttcgagt
tcgcacacgctgatcggctcgatcatcggcgtcggtctgatgaatcagatcatgcatggt
acgaacggcaccagcggcgtcgactggaatcaggcgctcggcgtcggcaagtcgctgctg
ttttcgccgatcgtgggctttctgctcgcgggcttgctgctgctgatcctgaaggccctc
gtgcgcgtgcccgcgctgtacgccgagccgaagggcacggagccgccaccgttctggatt
cgctgcctgctgattctgacttgcacgggcgtgtcgttcgcgcatggctcgaacgacggc
cagaaaggcatgggcctgatcatgctgatcctgatcggtacggtgcccactgcctacgcg
ctgaacaaggcggtcacggcggagcaatcccagaacttcgtcgcggtcgcgcatcaaacc
gtggcgacgctgtcgcgttacacccagggcgcggcgccctccgcggatccgcgcgccgac
gtcgaggcattcgtgcgcacccgccagctgacgcccgctacgctgccggcgctgcagcaa
ctggccgggcagatcggtcgccaggtcggcgaatcaggctcgatggccgcggtgccgcaa
ggcatcgtcgataacgtgcgcaacaacatgtatgtcgcgtccgaggcgatccgtctgatg
cagaaggccaatcagccgcagttctcgcccgacgacgcgaaggtcatcgccaacttccga
acgcaactcgatcacgcgaccaagttcattccgccgtgggtcaaggtggcggtcgcgatc
gcgctgggtctcggcacgatggtcggctggaagcgcatcgtcgttacggtaggcgagaag
atcggcaagcagcatctgacctacggccagggcgcggcggcggaagtcgtcgcgatggtc
acgatcggtgccgccgatgtctatggtctgccggtgtcgacgacccacgtgctttcttcc
ggcgtggccggcacgatggcggccaacggctcgggtctgcaatgggccacggtgcgcagc
ctgatcctcgcatgggtgctgacgctgcccgcctcgatcgcgctcgccggcgggctgtac
tgggtattccgttcggtgttctga

DBGET integrated database retrieval system