KEGG   Paraburkholderia sprentiae: BJG93_26840Help
Entry
BJG93_26840       CDS       T04610                                 

Definition
(GenBank) formaldehyde dehydrogenase, glutathione-independent
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
pspw  Paraburkholderia sprentiae
Pathway
pspw00625  Chloroalkane and chloroalkene degradation
pspw00680  Methane metabolism
pspw01100  Metabolic pathways
pspw01120  Microbial metabolism in diverse environments
pspw01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pspw00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    BJG93_26840
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BJG93_26840
Enzymes [BR:pspw01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     BJG93_26840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C PALP FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: APA88902
UniProt: A0A1I9YRT8
Position
2:complement(2355753..2356952)
Genome map
AA seq 399 aa AA seqDB search
MSSNRGVVYLGQGKVEVQSIDYPKMVDPRGRSIGHGVILKVVSTNICGSDQHMVRGRTTA
EVGLVLGHEITGEVIEIGRDVETLNVGDLVSVPFNVACGRCPTCKAQHTGVCLNVNPSRA
GGAYGYVDMGGWIGGQAEYVLVPYADFNLLKFPDRAQAMAKIRDLTCLSDILPTGYHGAV
MAGVKPGATVYIAGAGPVGMAAAASARLLGAACTIVGDMNEERLAHARKMGFQTINLSKD
ATLGEQIEQILGKPEVDCAVDCVGFEAHGHGSSGSHEEAPATVLNSLMEITRAAGAIGIP
GLYVTDDPGSADAAARRGSLSLRFGLGWAKSHSFHTGQTPVMKYNRDLMQAILWDRLPIA
DIVNVTVVSLDDAPEGYRQFDGGAPKKFVIDPHGLLKAA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaatcgcggcgtcgtgtatctggggcagggcaaggttgaagtgcagtcgatc
gactatccgaagatggtcgatccacgcggcaggtcgatcggtcacggtgtgatcctgaaa
gtggtgagcacgaatatctgcggctccgatcagcacatggtgcgtggccgcacgaccgcc
gaggtcggcctggtactcgggcatgagattaccggcgaagtgatcgagatagggcgcgac
gtcgagacgctcaacgtcggggatctggtatcggtgccgttcaacgtcgcgtgcggacgc
tgtccgacctgcaaggcgcagcatacgggagtgtgcctgaacgttaatccgtcacgcgcg
ggcggcgcgtatggttatgtcgacatgggcggctggatcggcgggcaggccgaatacgtg
ctggtgccgtacgcggacttcaatctgctgaaatttccggaccgcgcgcaggcaatggcg
aagatccgcgacctgacctgcctgtccgacattctgccgaccggctatcacggcgcagtg
atggccggcgtgaagccaggcgcgaccgtctatatcgcgggcgcgggaccggtcggcatg
gcggcggccgcgtccgcgcgcctgttgggcgcggcctgcaccatcgtcggcgacatgaat
gaggagcgcctcgcgcatgcgcgcaagatgggcttccagaccatcaatctatcgaaggac
gccacgctcggcgaacagatcgagcagatcctcggcaagcccgaagtggattgcgcggtg
gactgcgtcggcttcgaagcacacggtcacggcagcagcggctcacacgaggaagcgccg
gccacggtgctcaattcgctgatggaaatcacgcgggcggctggcgcgatcggcattccc
ggactctacgtgaccgacgatccgggctcggccgatgccgccgcgcgccggggcagcctc
agtttgcgtttcgggctcggctgggccaagtcgcattcgttccacaccgggcagacgccg
gtcatgaagtacaaccgcgatctgatgcaggcgatcctttgggatcgtttaccgatcgcg
gatatcgtcaatgtgacggtggtgtcgctcgacgatgcgcccgaaggctaccggcaattc
gacggcggcgcgccgaagaagtttgtgatcgacccgcacgggttgttgaaggcggcttga

DBGET integrated database retrieval system