KEGG   Paraburkholderia sprentiae: BJG93_29480Help
Entry
BJG93_29480       CDS       T04610                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
pspw  Paraburkholderia sprentiae
Pathway
pspw00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:pspw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BJG93_29480
Enzymes [BR:pspw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BJG93_29480
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BJG93_29480
    1.1.1.-  
     BJG93_29480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 Glu_dehyd_C AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: APA89620
UniProt: A0A1I9YTU0
Position
pl1WSM5005:302882..303775
Genome map
AA seq 297 aa AA seqDB search
MTNGHAPHFTLPENSTLGHEFAGEVVAVGKGVEKLKLGDAVTALPFVGCGHCAICLSGKP
NFCADFQGAAAGFAQYAVVAERVTTALPKTLSMEDGALIEPMAVGLHGVALAKLAPGAKV
LVIGAGPVGLAATFWARRLSAGRIVVTASSLRREALALHMGADEFVVPHEGQDLAALAGD
ALKGPPDVVFECAGQKDLIAKAIHCVKPQGDVVVLGFCTVPDQFIPAVAVWKEVRIQFAV
TYSMQEFTHVANVFDAGCVEPRAMITDRVSLDALPEVFEGLRDRSTQCKVMVNPWLS
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatggacacgcaccgcatttcacgcttccagaaaactcgacacttggccacgaa
ttcgctggcgaggtggttgccgtcggaaagggtgtcgagaagctgaagcttggcgatgca
gtgaccgcgctgccgtttgtcggatgcgggcactgcgcgatttgtctttccgggaagccc
aacttttgcgcggatttccagggggccgccgccggcttcgcccagtatgcagtcgttgcc
gagcgtgtaacgaccgcgcttccgaagacgctgagcatggaagatggtgcactgatcgaa
ccgatggcagttggcttgcacggcgttgcgctggcaaaactcgcgccgggtgccaaagtg
ctcgtgattggcgcgggtcccgtcgggcttgcggcgacgttctgggctcgccgccttagc
gccggacgcatcgtcgtcaccgcttcctcactgcgccgcgaagcgcttgcgctgcacatg
ggtgcagacgagtttgtcgttccgcacgaggggcaggatctggcggcgctggcgggggat
gctcttaagggtccaccagacgtcgttttcgaatgcgcggggcaaaaggatctgattgcg
aaggcgattcactgcgtcaagccgcagggcgacgtcgtagtgctcggcttctgcacggtg
ccagatcaatttatccccgcggtagcggtatggaaagaagtgcgaatccagttcgctgtc
acctacagcatgcaagagtttacgcatgtcgctaacgtgttcgacgcgggttgtgtcgaa
ccgcgcgcgatgatcacggatcgcgtctctctcgacgcgttacccgaggttttcgagggt
ctgcgtgatcgctcgacgcaatgcaaagtcatggtgaacccatggctgagctga

DBGET integrated database retrieval system