KEGG   Paraburkholderia sprentiae: BJG93_29750Help
Entry
BJG93_29750       CDS       T04610                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
pspw  Paraburkholderia sprentiae
Pathway
pspw00260  Glycine, serine and threonine metabolism
pspw01100  Metabolic pathways
pspw01110  Biosynthesis of secondary metabolites
pspw01120  Microbial metabolism in diverse environments
pspw01130  Biosynthesis of antibiotics
pspw01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pspw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BJG93_29750
Enzymes [BR:pspw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     BJG93_29750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 Aminotran_3
Motif
Other DBs
NCBI-ProteinID: APA89667
UniProt: A0A1I9YTX6
Position
pl1WSM5005:364021..365106
Genome map
AA seq 361 aa AA seqDB search
MQDFPIFDSRHAHHARLADLRSDTVTRPTEAMYACMREAPVGDDGLDGDPTVHALETAVA
AMLGKDAGLYVPTCTMANLLAVLAHTQRHEQVLLESSAHMFTTERGGSLLAGLAYTPIEG
KAGAMDLDRLEAAVRPGSHRIRVGLIAMETSHNNAGGAVLPLAHMQGAHQIARGAGVSVH
IDGARLMNAAAALNLPAATLAQHAESVSLCLSKGLSAPVGAVLAASDAAIARARAYRKML
GGTQRQAGIMAAAGLEALRTMSKRLADDHAKARVLSTRLNALGAPLPFAAGEPQTNIVQV
HVGGTGMSSHQWVKALAELGVLTRPWGEKTIRCVTHRHIDDADISHTVDAFAQVLEKQGQ
A
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgcaggactttcccatttttgattcccgccacgcacatcacgcgcggctggcagatctg
cgcagcgataccgtcacccgcccgaccgaggccatgtatgcgtgcatgcgtgaggcgcca
gtcggcgatgatggtctcgatggcgatccgaccgtccatgcgcttgaaaccgccgttgcg
gcgatgctaggcaaggacgccgggctctatgtgcccacctgcacaatggcgaacctgctc
gcagtgcttgctcatacgcaacggcacgaacaggtactgctcgaatcgagcgcccatatg
ttcaccaccgagcgcggcggctcgttgcttgctggccttgcttacacgccaatcgaaggc
aaggccggcgcgatggatctggaccggctcgaggcggccgtcaggcccggttcccacagg
atccgagttggcctcatcgcgatggagacgtcacacaacaatgccggcggcgctgtattg
ccactcgcacatatgcagggtgcgcatcagattgcgcggggggccggcgtatccgtgcac
atagacggcgcgcgcctgatgaatgcggcggccgcactcaacctgcccgcggcgacgctt
gcgcaacatgcggaatccgtttcgctgtgtctctccaaaggcctgagcgcacctgttggc
gcggtgctcgcggcgagcgatgccgcaattgcgcgagcgcgggcatatcgcaagatgctt
ggcggcacgcagcgccaggcaggcatcatggccgccgccggccttgaagccctgcggacc
atgagcaagcgacttgcggacgaccacgccaaggcgcgcgtgcttagcacgcgtctgaac
gcgctaggcgcgcccttgccctttgccgccggtgaacctcaaaccaatatcgtgcaggtg
cacgtcgggggaacaggaatgtccagtcatcaatgggtcaaagcgctagccgaattgggc
gtactgactcgtccgtggggcgaaaaaactatccggtgcgtgacccatcgccatattgac
gatgccgatatcagtcacaccgtcgacgcgttcgcacaagtgttagaaaagcaggggcag
gcatga

DBGET integrated database retrieval system