KEGG   Paraburkholderia sprentiae: BJG93_34005Help
Entry
BJG93_34005       CDS       T04610                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pspw  Paraburkholderia sprentiae
Pathway
pspw00071  Fatty acid degradation
pspw00072  Synthesis and degradation of ketone bodies
pspw00280  Valine, leucine and isoleucine degradation
pspw00310  Lysine degradation
pspw00362  Benzoate degradation
pspw00380  Tryptophan metabolism
pspw00620  Pyruvate metabolism
pspw00630  Glyoxylate and dicarboxylate metabolism
pspw00640  Propanoate metabolism
pspw00650  Butanoate metabolism
pspw00900  Terpenoid backbone biosynthesis
pspw01100  Metabolic pathways
pspw01110  Biosynthesis of secondary metabolites
pspw01120  Microbial metabolism in diverse environments
pspw01130  Biosynthesis of antibiotics
pspw01200  Carbon metabolism
pspw01212  Fatty acid metabolism
pspw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pspw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BJG93_34005
   00630 Glyoxylate and dicarboxylate metabolism
    BJG93_34005
   00640 Propanoate metabolism
    BJG93_34005
   00650 Butanoate metabolism
    BJG93_34005
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BJG93_34005
   00072 Synthesis and degradation of ketone bodies
    BJG93_34005
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BJG93_34005
   00310 Lysine degradation
    BJG93_34005
   00380 Tryptophan metabolism
    BJG93_34005
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BJG93_34005
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BJG93_34005
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BJG93_34005
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pspw04147]
    BJG93_34005
Enzymes [BR:pspw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BJG93_34005
Exosome [BR:pspw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BJG93_34005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: APA90656
UniProt: A0A1I9YWQ3
Position
pl2WSM5005:complement(359237..360424)
Genome map
AA seq 395 aa AA seqDB search
MRRAVIVSTARTPIGKAFRGSLNCTKSPTLMGHAIRHAVRRASAEGSEVDDVVVGTVLGA
GTAGGNLARFAALAAGLPETVSGQTLDRQCSSGLMAIATAAKQIMVDGMQIVVAGGQENI
SALQERYMAWTADEQDPAVVASAAHAYMPMLQTAEFVSEKYGLSRIAQDEYALESQLRTA
AAQRAGVFDDEIVPIRTTMKVVDNATQTISFKEVELARDEGNRPDTTLDNLQKLQPVLEG
GRVTAGNASQLSDGASACVLMDSQLAERRGLDILGTYLGMAVAGCAPEEMGIGPVYAIPK
LLAHHGLRVQDVGLWELNEAFACQALYCRDRLGIDPLSYNVHGGGISVGHPYGMTGARLV
GHALLEGRRRKVRYVVVSMCVGGGMGAAALFEVAM
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
ttgcgaagagcggtcattgtttcgacggcgcgaacgcccatcggcaaagcgttccgcggg
tcgctgaattgcacgaaatctccaaccctgatggggcatgccatccgtcacgcggtgcgg
cgagcatcagctgagggatccgaagttgacgacgttgttgtaggcaccgtgcttggtgca
ggaacggcaggagggaatctggcacgttttgcggcactggccgcaggcctacctgagacc
gtgtccggtcaaactcttgaccgccagtgctcgtcaggtttgatggcgatcgcgactgcc
gccaagcagatcatggttgatggaatgcaaatcgttgtcgcaggcggtcaggagaacatt
tccgccttgcaggagcggtacatggcttggacagcggacgagcaggatcccgcagtcgtc
gcttctgccgcgcatgcctacatgccgatgttgcagaccgcagaattcgtgtcggaaaag
tacggcctcagccggatcgcgcaagacgagtacgcactcgaatcgcagttgcgaacggcg
gcggcgcaacgggccggcgtgtttgacgatgagatcgttcccatccgcacaacgatgaag
gtggtcgacaacgctactcagacgatctcattcaaggaggtcgaacttgcgcgcgatgag
ggcaatcgacccgacacgacgttggacaatctccagaaattgcaaccggttctggaggga
gggcgggtgacggcgggcaatgcaagtcagctctcagatggggcgtccgcgtgcgtcttg
atggacagccagctcgcggagaggcgtggactagacattctcggtacctaccttggcatg
gccgtggctggttgtgcgccggaggaaatgggcattggcccagtctatgccatcccgaaa
cttctggcccatcacggtctgcgagttcaggacgtgggcctgtgggaattgaacgaggcg
tttgcgtgccaggctctctactgccgcgaccggcttggtattgacccgctcagctacaac
gttcacggcggaggcatttccgtcgggcatccctacggcatgaccggtgcacggctcgtc
ggacacgcgttgctcgaaggacggcgacgaaaggtccggtatgtagtcgtatcgatgtgc
gtgggtggtggcatgggtgctgcagctctttttgaggttgccatgtga

DBGET integrated database retrieval system