KEGG   Punctularia strigosozonata: PUNSTDRAFT_102931Help
Entry
PUNSTDRAFT_102931 CDS       T03131                                 

Definition
(RefSeq) hypothetical protein
  KO
K02365  separase [EC:3.4.22.49]
Organism
psq  Punctularia strigosozonata
Pathway
psq04111  Cell cycle - yeast
psq04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:psq00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    PUNSTDRAFT_102931
   04113 Meiosis - yeast
    PUNSTDRAFT_102931
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:psq01002]
    PUNSTDRAFT_102931
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:psq03036]
    PUNSTDRAFT_102931
Enzymes [BR:psq01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.49  separase
     PUNSTDRAFT_102931
Peptidases [BR:psq01002]
 Cysteine Peptidases
  Family C50: separase family
   PUNSTDRAFT_102931
Chromosome and associated proteins [BR:psq03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   Separase
    PUNSTDRAFT_102931
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C50 CHAT TPR_12 TPR_1
Motif
Other DBs
NCBI-GeneID: 18875760
NCBI-ProteinID: XP_007384121
JGI: 102931
Position
Unknown
AA seq 1612 aa AA seqDB search
MERACFKVRRALDKLRRAAIKLVDRGDEKGSSVKEEVLGFLEKMIELLESTAKKVSVAAR
QDLVTPAIDTLFLLARIRLVPQRTSTIALSFELLSRALRLIGVTPSPNDERAANYLRCIS
GAYHNLACVLYQAGMHAYAIRFLVEGCRFGLKATRAHEDASRAKTPLMWKHEDAWVQLRG
QLYRRWELLGACYSKIGDTKAAYNAYVHAITTYPFLEPPFLDLVESGNITKAFEASPASR
QIGNIIDRVTYMATQDMFREPEDVPLTSAFEHAWPNGVESRFNLVIAAVLERQAESLIAS
RWKENVSIAILALLEAALAIYTPEKWPYRRARLLLKILETTYHTSAEPVRRRGRDFQQIG
EEIQKLIAHSQDIGCDDVIRMYGDEYIVSAHLWISLHYHREQRVTDCLQSAQSAWDVSKR
KFLHLSQRTPAKSMAAKGLSSPKRARAAPKGRTTTIKKGALPRPSIRPVVSARSKQSRTT
TSRIKAKDPVTPKPRHVFEAPSRSPVTPPRKADAAVSTMVLDNPEKLLTLFDTTCQLIGL
IGHISLRIRLLSVARRICESSLDSHIERFVKVSTELARNYATLGKSYKAALIFQQGADVI
SRFQTRVSTDVRLLFLLHHAATLALMDDIHTSAKLYCEAVALSSATKDEERGVSTSDRVR
SRARRLVRTATASDVYAIIQSARAEPAESLSAMLRSLRLWNRAVEALSRLAPRPNDHNAS
RVSVIDGSEWAISEGLLLAMFSVSRMYLVRGSAREAQYFAQQTEELAMSLSAYAMIARAL
AGQAEIQLHLRQLEDAKNLISRAAAMVEDLPGIEAADIYRLHGDYNRLSARREDAHKLYT
EATATLDGLAMSFSVIDALVTRPSTATVTKAEDSSFETLAPRLLSTILWQQIWLLRENVN
DENYRVLLDRLLALPSSTDAEQNSLIAKLTLHDIFSRFRSDIYLSTLGETAIAIPMGMLS
DKGTSPPASLQEVLGIFAGAEQLWWANLASTAMKGEVLRVRDGALSLASVQALQASLGQN
PETGPIVAMRLLDIAASLTIRREMLEATRHKISELEAGDDLAWSLMTPNGSPLGPARNST
PKPSWDSDSEEDEDSNAEADGLSVYWKGIYGKYQQLPMDVSSLSSSQAEQLPDNWVVVNI
NLAEDRDTLYISRQRKGKDSLMFCLPLKGRRDSDEENHLTLDGAVAEMKDIVKLNDEGTR
SAATVDVKDKQARVAWWAGRTELDQRLRDLLENIEFCWLGAFKTILSPAIAVNGGALAHF
REGLEKVLKRGLNLRNKKEMSRLRLSDGLLECFSNLSPQCRDEELEDLVYFMLDLYQFHG
VAVAVSEIDVDQVAVDLRSVLEEHAKRSGSPTTNNDSHLFLVLDKDLQGIPWESIPVLRG
KSVSRIPCMEFLLDRLQFEDWQRSSVTGSSPKPNNKAADRATVDPRRTYYLLNPSGDLKG
TQSRFSDWLETMRSVGWQGITGRPPSEQQFLDALNRKDLVIYFGHGGAEQYVRSHKVRHL
SRCAATLLWGCSSGALKEMGDFDRVGTPYNYMVSGCPTLVANLWDVTDRDIDKFSQAVFD
KLRLDPDHVKNWDGAEGGKVSLMEAVAKSRDVCKLKYLNGAAPVVYGIPFYL
NT seq 4839 nt NT seq  +upstreamnt  +downstreamnt
atggaacgggcttgtttcaaggttcgaagggctctcgacaagctccgccgtgctgctatc
aagctcgtggatcgtggtgatgagaagggttcgtctgtgaaagaagaggttctggggttt
ctcgagaagatgattgagcttttagagtccacggcgaagaaggttagtgtagctgctcgt
caagacttagtgacacctgcgattgatactttgtttctgcttgcgcgcatacgactggtg
ccccagcggaccagtaccatcgccctctccttcgagctcctttctcgggcactccggctt
atcggcgtaactccgagtcctaatgacgagcgcgcggcgaactacctccgttgcatatcc
ggtgcatatcacaacctggcgtgcgtgctttaccaagcgggcatgcatgcctatgctatc
cgctttttagtcgaaggatgtcgttttgggctgaaggccacgcgagcacacgaagatgca
tccagagcgaagaccccattaatgtggaaacacgaagacgcctgggtgcaattgcgaggc
cagttatacaggagatgggagcttctgggggcgtgttactccaagatcggtgatactaag
gccgcttacaatgcatacgttcatgctatcactacttacccctttcttgaacccccgttt
cttgatttagtggagtcgggaaacataactaaggcattcgaggcctcacccgcttcaagg
caaattgggaacatcatcgaccgggttacatatatggcgacgcaggatatgttccgcgag
ccggaagacgttccgttgacgtcagcatttgagcacgcttggccaaacggcgttgaatcg
aggtttaatcttgtgatagccgcagtgctggagaggcaggccgagagtctcatagcgagc
cgatggaaggagaatgtcagcatcgcgatcctagcgttgctggaagccgcgcttgcgatt
tatacaccagagaagtggccgtatagaagggctagattgctgctcaagatcctcgaaacc
acatatcacaccagtgcggaacctgttagaaggaggggtcgggactttcagcagataggc
gaggagatccagaaattaatcgcccattcgcaggatatcggatgtgatgatgttattcgg
atgtacggagacgagtacatcgtctcggcgcatctgtggatatccttacactatcatcgc
gaacagcgtgttacggattgtctccagtcagctcaatccgcctgggacgtaagtaagagg
aagttcctccatctcagtcagcgaacccccgccaaaagcatggcggccaaagggttgagc
tctccaaagagggccagagcggcgcccaaaggcaggacaacgacgatcaagaagggcgct
ctacccaggccctcaatacggcccgtagtttcggcacgctcgaaacaatcccggacaacg
acatctcggattaaagcgaaggatcctgtcaccccgaagcctcgacacgtgtttgaggct
ccctctcgtagccccgtcacaccgccacggaaggcagatgctgctgtatcaacgatggtg
ctcgataatcccgagaagttgttgacactattcgacaccacgtgtcaattgattggcctc
atcggtcatatttcgctgaggatcagattactcagcgtcgctcggcgaatatgtgaatca
tctctggacagtcatattgaacgttttgtcaaggtttccacggagttggctcgcaactat
gccactctaggaaaatcttataaagcagctttgatattccaacaaggggcggatgtcatc
agcagatttcagactcgtgtatcaactgacgtgcgcctgctcttcctgctccaccatgcg
gccactctggcattgatggacgatattcatacaagtgcgaagctctactgcgaggccgtc
gcactgtccagcgccactaaggacgaagaaaggggcgtctccaccagtgatcgggttcgg
tctcgggctcggcgcctagtgcgaactgcgacagcatcggatgtgtatgctatcatccaa
tccgcgagggctgaacctgctgagagtctgagcgcaatgttgcgatcactccgcttgtgg
aaccgtgcggtagaagcattgtcccgattagctccccgaccgaacgatcacaatgcctct
cgagtatcggtcatcgatggttcagaatgggcaatctcagagggtcttctccttgccatg
ttctcggttagtcggatgtacctcgtgcgagggtctgcacgagaagcgcaatacttcgct
cagcaaaccgaggagctagccatgtccttaagtgcatatgcgatgattgcgagagcactc
gccggacaggcagagatacagctacatctccggcaacttgaagatgccaaaaatctcatt
tcccgtgccgctgcgatggtggaagatttacctggtatcgaggcagctgacatctaccgc
cttcacggcgattacaacagactatcggctcgtcgagaagatgctcacaaactttacact
gaggctacagccacgctggatggccttgctatgtcgttctccgttatagatgctcttgtg
acgagaccgagcacagctactgtcaccaaagcagaagattcgagcttcgagacattggca
ccgcgtttactgtcaactatcctgtggcaacaaatatggctgctcagggaaaacgtcaac
gacgaaaactaccgagttttgctggacagactactcgctctgccatcgtcaacagacgcg
gaacagaactcactgatcgcaaagctcacactacatgacatcttctcccgatttcgttcg
gatatctatttgagcacgctgggcgagacagcaatcgcaatccctatgggcatgttgagc
gataagggcacaagcccgcctgcttcgttacaggaggtccttggtatatttgccggcgcc
gagcagctttggtgggctaacctggcctcaacggcaatgaagggcgaggttttgcgcgtc
cgagacggcgctctatccctagcatcggtgcaggcccttcaagcctctctagggcagaat
ccggagacaggacctatcgtagccatgcgactccttgatatcgcggcatcgttgactata
cgccgtgaaatgctcgaggcaactcgtcacaaaatctcggagctcgaggcaggagatgac
ctagcgtggtcgctgatgacgccgaatggatcgcctctagggcccgcaaggaacagcacc
cccaagccaagctgggactcggactcggaagaggacgaagacagcaacgctgaagccgac
gggttaagtgtctactggaaagggatttacggcaaatatcaacagctgccgatggatgtc
tccagcctctcttcttctcaggctgagcagctccctgataattgggtcgttgtcaacatc
aatctcgccgaggaccgcgataccttgtatatcagcagacaaaggaagggcaaggactct
cttatgttctgtctgcccttgaaaggtagacgggatagtgacgaggaaaatcacctaaca
ctcgacggtgcggtggctgagatgaaggatatcgtcaagcttaacgacgagggaaccagg
agtgccgccacggtcgatgtcaaggataagcaggcccgggtagcatggtgggctggtcgt
accgaacttgatcaacgtctgcgagacctcttggaaaacatagagttctgctggctaggg
gcattcaagacaatcctcagcccagcgatcgctgtaaacggtggtgcccttgcccacttt
cgcgaaggtctggaaaaggttctcaagcgcggattgaacttgcgaaacaagaaggagatg
tcacgcctacggctgagcgacggactcctcgaatgcttttctaatctctccccacaatgc
cgcgatgaggaactcgaagatctcgtctatttcatgctggacctttaccaattccacggc
gtagctgttgctgtttcggaaatcgacgtggatcaagtggcggtagacttgcgctctgtt
cttgaagagcacgccaagcgcagcggctcgcctacgacaaacaacgacagccatctgttc
ctcgttctggataaggatcttcaaggcattccttgggaatccattcccgtattgaggggt
aaaagtgtcagccgaattccgtgcatggagttcctgttagaccgcctccaatttgaggat
tggcagaggtcatcggtaactggctcctccccaaagccaaacaacaaggccgcggaccgg
gccaccgtagacccgcggagaacgtactatctcctgaatcccagtggagatcttaaagga
actcaaagtcggttcagcgactggctagagacgatgagatctgtgggctggcaaggtatt
accgggcggccgcctagtgaacagcagttcctggatgccttgaaccggaaagatctcgtg
atctacttcggccacggaggtgcagagcaatatgttcgctcgcacaaagtccggcacttg
tcacgttgcgcagcgaccttgctctggggttgctcgtcaggtgccctaaaggagatgggc
gactttgaccgggttggtacaccctataactacatggtctctggatgtccaacccttgtc
gcgaatctttgggatgtgacggacagggacatcgacaagttttctcaggctgtctttgac
aagttacgccttgaccccgaccatgtgaagaactgggacggcgcagaaggaggcaaagtt
tcgctgatggaggccgtcgcgaaatctcgcgacgtttgcaagctgaagtacctgaatgga
gctgcaccggtggtatacggtatcccattctatctttga

DBGET integrated database retrieval system