KEGG   Punctularia strigosozonata: PUNSTDRAFT_112613Help
Entry
PUNSTDRAFT_112613 CDS       T03131                                 

Definition
(RefSeq) NAD(P)-binding protein
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
psq  Punctularia strigosozonata
Pathway
psq00520  Amino sugar and nucleotide sugar metabolism
psq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PUNSTDRAFT_112613
Enzymes [BR:psq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     PUNSTDRAFT_112613
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD NAD_binding_4 RmlD_sub_bind Polysacc_synt_2
Motif
Other DBs
NCBI-GeneID: 18876479
NCBI-ProteinID: XP_007382323
JGI: 112613
Position
Unknown
AA seq 430 aa AA seqDB search
MVATQIRTVDKSGHEMTSVGFQRFGFDCEVPLDVLRSLYLRPHYVLTAQSDGSQTPNPAE
QEEQHARFTHALAGYQSKSIYHPDTQSISYTTLSRFPPVKLLPPSSRKRILVTGGAGFVG
SHLVDRLMLLGHEVTVLDNFFTGSKTTVSHWVGHPNFEMVRHDVVEPFMIECDQIYHLAC
PASPPHYQFNAVKTIKTSFMGTLNMLGLAKRTKARFLITSTSEVYGDPEVHPQHEDYWGH
VNPIGPRACYDEGKRVAETLTYGFHRQDGVDVRVARIFNTYGPRMNPFDGRVVSNFIVQA
LKGEDMTVYGDGKQTRSFQYIHDLIDGLIALMNSDETRPTNIGNGDEFTIGEFAELVREI
VEEVQKEDGDELPNRVKIVYKPIPTDDPQKRRPDTTRAKQSLDWEPRWSVRMGLEEMVRY
YKAKMAEGSI
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggtcgccacacagatccgtaccgtcgacaagagcggccatgaaatgacttcagtgggc
tttcagcggtttggatttgactgcgaggtccccctcgatgtcctgcgctctctctacctg
agaccgcattacgtccttaccgctcagtccgatggatcccagacccccaaccccgccgag
caggaagagcaacatgcgaggttcacccacgctctcgccggctaccagtccaaatcgatc
tatcatcccgacacccagtccatctcctacacgactctgtctcgcttcccgccggtcaag
cttcttcctccttcatctcgcaagcgcatccttgtgacgggaggcgcaggtttcgttggc
tcgcatctcgtcgaccgcttgatgctgctcggtcatgaagtcactgtcttggacaatttc
ttcaccggatccaagacgactgtcagccactgggttggtcacccgaactttgagatggtt
aggcacgatgtcgtcgagccgttcatgatcgagtgcgatcaaatctaccaccttgcttgc
ccggcatcgcctccccactatcagttcaacgcggtcaagaccatcaagacttcattcatg
ggcactctgaacatgttgggtctcgcgaagcggacgaaagctcgctttttgatcacgagc
acatccgaggtctacggtgaccccgaagtgcacccccagcacgaagactactggggacac
gttaaccccatcgggccgcgcgcctgctacgacgagggcaagcgtgttgcggaaaccctg
acttacggcttccaccgtcaggatggcgttgacgtccgtgttgcccgcattttcaacact
tacggcccgcgcatgaacccattcgacggacgcgtcgtctccaacttcatcgtgcaggcc
ctaaagggcgaggacatgaccgtctacggagacggcaagcagacgcgctccttccagtac
atccacgacctcatcgatggtctgatcgcgctcatgaattcggacgagacccgtccgacg
aacatcggcaatggtgacgagttcacgatcggcgagttcgccgagctcgtgcgcgagatt
gtcgaggaggtgcagaaggaggatggcgacgagctccctaaccgcgtcaagatcgtctac
aagccgatacccacggacgatccgcagaagcgccggcctgacacgactcgggccaagcag
agcctcgactgggaaccccgctggagcgtgcgcatgggattggaggagatggtgcggtac
tacaaggccaagatggcggagggcagcatctga

DBGET integrated database retrieval system