KEGG   Punctularia strigosozonata: PUNSTDRAFT_141766Help
Entry
PUNSTDRAFT_141766 CDS       T03131                                 

Definition
(RefSeq) gamma-glutamyltranspeptidase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
psq  Punctularia strigosozonata
Pathway
psq00430  Taurine and hypotaurine metabolism
psq00460  Cyanoamino acid metabolism
psq00480  Glutathione metabolism
psq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    PUNSTDRAFT_141766
   00460 Cyanoamino acid metabolism
    PUNSTDRAFT_141766
   00480 Glutathione metabolism
    PUNSTDRAFT_141766
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:psq01002]
    PUNSTDRAFT_141766
Enzymes [BR:psq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     PUNSTDRAFT_141766
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     PUNSTDRAFT_141766
Peptidases and inhibitors [BR:psq01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   PUNSTDRAFT_141766
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-GeneID: 18880793
NCBI-ProteinID: XP_007380912
JGI: 141766
Position
Unknown
AA seq 584 aa AA seqDB search
MGPSLRRLALRTSVLLTLGAVASANTGVQTFGTSGKHGAVATEVGECSDIGVSILKQGGS
AADAIIASGLCVGTIAAYHSGIGGGGFMLVRFEDKHGKGHSYEMIDFRETMPAAGNETMY
INTTVAHASTIGGLAVGVPGELRGWEKLHERHGKLPWKTLFQPAIKLAQDGFKVTTDLAV
ALNANTYPFLLSDPLWAEVYAPNGTLVGLGDTVYRKRYARTLAAIAEHGPDYFYGPHTEI
AVNTAEAVHSRGGILTTADLANYSAIIREPVNITYRGTHRIFSTVAPSSGSVVLSALKIF
EGYDGSAAPTDPAINLTTHHLIQGTRFGYGQRTNYGDPAFTANVSTLEREFLQESTVEAI
RKEISDNQTFPAAYYDINKYIPLNDSGTSHMAAVDRWGNAVSLTTTVNLYWGSQVMTADG
VILNDEMDDFSSPGQTNSFGFAAAPVNFIRPGKRPQSSISSSIAEDLETGEFVIATGSAG
GSRIITATLQNLYHYLDQGLTPNETVHQSRWHDQLTNVTYFEISAPNLGIAGFSNATVAY
LAGLGYNITYEDESGSTAHVIGKKDGVYTAASDPRKTAGRGAAF
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgggcccctcactccgccgccttgcacttaggacctctgtccttctcactcttggcgcg
gtcgcgtcagcgaacaccggggtccagacgtttggtacgtccggcaagcacggcgctgtc
gcgactgaggtcggagagtgctctgatattggtgtttcgattctgaagcaaggcggaagc
gcggcagacgcgatcatcgccagcggactatgtgtcggaacgatcgcagcgtaccattcc
ggaattggtggaggtggattcatgttggttcgctttgaggacaagcacgggaagggccac
tcctacgaaatgatcgatttccgggagaccatgcccgccgccggtaacgagaccatgtac
atcaacacgaccgtcgcccatgcatccaccatcggtggcctcgccgtcggcgtacccggc
gagctgcggggttgggaaaagctgcacgagcgccacggcaagctgccttggaagacgctc
tttcaacctgccatcaagctcgcacaggatggcttcaaggtgacaacggatctcgcggtc
gcccttaacgccaacacctacccgttccttctctccgacccgctctgggccgaagtttac
gcgcccaacgggactctcgttggtctcggcgacaccgtctaccgcaagcgctacgcgcgt
acgctcgccgccatcgcggaacacggccccgactatttctatggcccgcacacggagatc
gcggtgaacacggccgaggctgtccactcccgcggcggcattctcactaccgccgacctc
gctaactactccgccatcattcgtgagcccgtgaacatcacttaccgcggcacgcaccgc
atcttcagcaccgttgcgcctagcagtggcagcgtcgtgcttagcgcgctgaagatcttt
gagggctacgacggctccgcggcgccgaccgaccccgcgatcaacctcactacccaccat
ctcatccagggtacgcgcttcggatacggccagcgcacgaattacggcgacccggcgttc
actgcgaacgtatccacgctcgagcgcgagttcttgcaggagtcgactgtcgaggcgatc
cggaaggagatcagcgacaaccagacgttccccgctgcatactacgacatcaacaagtac
atccccctcaatgattcgggaacgagccatatggctgccgtcgaccggtggggtaacgct
gtcagtctgacgacgaccgtcaacctttactggggcagccaggtcatgaccgcagacggt
gtcatcctcaacgacgagatggacgacttctcgtcgccgggtcaaaccaattcgttcggc
ttcgccgccgcgcccgtcaacttcatccggcccggaaagcgcccgcagagcagcatctcg
agttccatcgcggaggacctcgagacgggcgagttcgtgatcgcgaccggctccgccggc
ggatcgcgcatcatcactgcgactctccagaacctgtaccactacctcgaccagggcctc
acgcccaacgagaccgttcaccagtcgaggtggcacgatcagctgacgaacgtcacctac
ttcgagatctcggccccgaacttgggcatcgcgggcttctcgaatgcgacggtggcgtac
ctcgccggcctcgggtacaatatcacgtatgaggacgagagcgggagcacggcgcatgtt
atcgggaagaaggacggcgtttacaccgccgcgagcgacccgcgcaagacggccgggcgc
ggcgctgcgttctga

DBGET integrated database retrieval system