KEGG   Punctularia strigosozonata: PUNSTDRAFT_144439Help
Entry
PUNSTDRAFT_144439 CDS       T03131                                 

Definition
(RefSeq) hypothetical protein
  KO
K00877  hydroxymethylpyrimidine/phosphomethylpyrimidine kinase / thiaminase [EC:2.7.1.49 2.7.4.7 3.5.99.2]
Organism
psq  Punctularia strigosozonata
Pathway
psq00730  Thiamine metabolism
psq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    PUNSTDRAFT_144439
Enzymes [BR:psq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.49  hydroxymethylpyrimidine kinase
     PUNSTDRAFT_144439
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.7  phosphooxymethylpyrimidine kinase
     PUNSTDRAFT_144439
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     PUNSTDRAFT_144439
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phos_pyr_kin TENA_THI-4 PfkB
Motif
Other DBs
NCBI-GeneID: 18881281
NCBI-ProteinID: XP_007385068
JGI: 144439
Position
Unknown
AA seq 568 aa AA seqDB search
MPLSYRTPAPPAVLTIAGSDSSGGAGIQADLKTFTALGCYGTSVITALTAQNTTGVQGVH
PSPPGFVAQQARHDFCSLDSVLSDTDVKALKTGMLYDSSNAQSVIKALQAHYGGGSRTMP
PLVVDPVCVSTSGHELLHPDAVDVIVKELFPLAHLITPNRQEAELFLSRCEDFSLRKIES
LGDMLTAARNLLSLGPNAVLVKGGHLTATLSDVDRLLSTESDVRLVKSLLLDEKMEVLKV
AQNVAQDPQLVVDVLCEKPGKSTLFVRPRLDSMSTHGTGCTLSAALVCMLARGDDLARAL
ENATLYTHLGIEHAFPMGSGHGPLNHIHSTTSRVIALPSPVNPHPLTYALIKSTSDVWKK
YVEHDFVKQLGSGTLRRESFVHFIKQDYHYLKYYARAYGLLVAKGFSFSAMKPAAQTIMN
VITESVMHKSFCAQWGVSEEELENTPESAATTAYGAFLLDTGIEGDYAKLVMALASCLLG
YGEVGLWLKKEAAKPKTWVKLEDNPYQKWIDDYSGEMYQSAVKTGIALIEDCAVADPPSA
KRFEEWKRVWARCTLFEKRFWDMAMELS
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgcccttaagctaccggactccagcccctcccgccgtgctcacgatagctgggtctgat
tcgagtggaggtgctggcattcaagccgacctcaagactttcaccgccctggggtgctat
ggcaccagcgtcataacggcgctgaccgcacagaatacgacgggagtgcagggtgtgcac
ccctctccgccgggttttgttgcccagcaggcacgacacgatttttgctcgctcgactcc
gtgctgagcgataccgatgtcaaggctctgaagacggggatgctctatgactcgagcaac
gctcaatccgttatcaaggcgttgcaagcgcactacggtggaggaagcagaacaatgccg
cctctcgtcgtcgatcccgtctgtgtctcgacatccgggcatgagctcctgcacccggac
gccgtcgatgtcatcgtcaaggaactcttccccctcgcgcatctcatcactcccaataga
caagaggcggagctgttcctctcgcgatgcgaagatttctctttgaggaagattgagtcg
ctcggagacatgctcaccgctgcaagaaacctgctctcactgggaccgaacgccgttttg
gtcaagggcggtcacctcactgcgactttgtccgacgtcgataggttgctatcgactgag
tcggacgtgcgcctcgtcaaatccctgttattggatgagaagatggaggtactgaaagtt
gcccaaaacgtcgctcaagatccacaactcgtcgtcgacgtgctctgcgagaaaccagga
aaaagtacgcttttcgtgcggccgaggctcgattccatgagcacgcatggcactggctgc
actctgagcgctgcactcgtgtgcatgcttgctcgaggagatgatctcgctcgggcgttg
gagaatgcaactctctatacacaccttgggatcgagcatgcgttcccaatgggctccggc
cacggtcctctcaaccacatacattcgacaacttcccgggttatcgcgctgccaagtccc
gtcaatcctcatccgctcacctatgcactgatcaagtccacgtccgatgtgtggaaaaaa
tatgtggagcatgacttcgtgaagcagctgggctctgggacattacggagagaaagcttt
gttcacttcatcaaacaagattatcattatctcaaatattacgcgcgtgcatatgggctt
cttgtcgccaagggcttttccttttccgcgatgaaacctgctgcccaaacgatcatgaac
gttatcaccgagtccgtcatgcacaaatcgttctgcgcccagtggggtgtatctgaggaa
gagctggagaacacgccggagtcggcagccacgacggcctacggcgcgttcttgcttgat
acgggcatcgagggcgactacgcaaagcttgtgatggctctggcatcgtgcttgctcggt
tacggcgaggttggcctttggttgaaaaaagaggctgcgaagccgaagacctgggtcaag
ctggaagacaacccgtaccagaaatggatcgacgactattcaggcgagatgtatcaaagt
gccgtcaaaacgggcatagctttgatagaagattgcgccgtggcggacccgccgagtgcg
aaacgttttgaggagtggaaaagggtttgggcgcggtgtactttgttcgagaagcgtttc
tgggacatggcgatggagttgtcgtag

DBGET integrated database retrieval system