KEGG   Punctularia strigosozonata: PUNSTDRAFT_41287Help
Entry
PUNSTDRAFT_41287  CDS       T03131                                 

Definition
(RefSeq) hypothetical protein
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
psq  Punctularia strigosozonata
Pathway
psq03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:psq00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    PUNSTDRAFT_41287
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:psq03041]
    PUNSTDRAFT_41287
Enzymes [BR:psq01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     PUNSTDRAFT_41287
Spliceosome [BR:psq03041]
 Complex C
  Other components
   Step II factors
    PUNSTDRAFT_41287
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Exo_endo_phos Helicase_C Lipase_3 S1 T2SSE DEAD AAA_22 AAA_30 AAA_19 RasGAP_C DUF2075
Motif
Other DBs
NCBI-GeneID: 18882393
NCBI-ProteinID: XP_007378780
JGI: 41287
Position
Unknown
AA seq 2630 aa AA seqDB search
MADADLYNLEFLSLVNKITQEINNHTGYNDKTLAEFVIALHDTSKTLPEFKQKLQEAGAD
FPDSFVENIDRLILSMHPRHKKKSKSKKGKGKSKEADVNGVTELDELDKKKRMFPGLSKP
DQEWQPSVTKDALMQEVDDMMAAFEGGAKKVRARESDEERSPKRQRREHPTSPPRRRSPS
PPRGHPYDDGGRGRHSQRNRQQLDERPVLYKIYDGRVQGLKEFGAFVQLEGVVGRVEGLV
HVSNIQTGARANSASDLLSRNQPVKVKVMSVAGSRVGLSMKDVDQVTGRDLTPHLRIKSE
AELLEEERQHSRLASSGANAIPVGGRASSGINEPVRSAKRLTSPERWEIKQLISSGAIDP
SEYPELDEDFSNTMARAEVEEDIDVEVREEEPAFLAGQTKRTLDLSPVKIVKAPDGSLNR
AALAGASLAKERRELRQQEVNEQADSQAHDFSAPWLDPMSKESDRVFAQDLRGNLRGQKA
GTEASWKQATFNKATTFGEITSLSIQDQRKSLPIYKLRDQLIEAIRAHQVLIVVGDTGSG
KTTQMVQYLAEEGFADHGRIGCTQPRRVAAMSVAKRVAEEVGCRLGQEVGYTIRFEDCTS
PETKIKYMTDGMLQRECLIDPNVSAYSVIMLDEAHERTIATDVLFGLLKSEFALLHVEYY
VLTPLPEAIKRRPDLKLIVTSATLDAEKFSKYFFGCPIFTIPGRTYPVEILYTKEPESDY
LDASLITVMQIHLSEPKGDILLFLTGQEEIDTACEILYERMKALGPKVPELIILPIYSAL
PSEVQSRVFEPTPEGARKVVIATNVAETSLTIPGIYYVIDPGFSKQNAYDPRLGMDSLVV
MPISQAQARQRAGRAGRTGPGKCYRLYTEAAFRNEMLPNSIPDIQRTNLAHTILMLKAMG
INDLLSFDFMDPPPAQTMLEALQSLYSLSALDDEGLLTPLGRKMADFPMEPKESKMLIAS
VELGCSEEILSIVAMLSVQSVFYRPKEKQGQADSKKAKFHQPEGDHLTLLAVYNGWKASN
FSNPWCYENFIQARSMRRAQDVRKQLLGIMDRYKHDILSAGRDFNLVRRAICSGFFRNAA
KKDPQEGYKTLVEGTPVYIHPSSALFNRAPEWLVYHELVLTTREYCHNVCAVEAKWLVEA
APQFFKVADAAKLTKRKKQEKIQPLYNKYEKPDEWRLSKFTLYIDNAPAHPHTCFRVVLV
NVDDEGGMPHQAAFHVATSSRQCGSVNGGVVRLDVVLGNLSRFCWGGIGVRGEHERLREN
PRLAVDGLARCGGRVAGRTSTVYDGPRHRYEKRGWLTSYGTSTGHIRATCCETSELTRNG
MAVKGLYFMSRARHAFDEFPHFVSALKRLSIPADRRRRAVEVGIHLEEVLGRTHSSLVSI
FEEEDDYTRGSHLANMSSTLRVCTLNCWGLKFVAKDRKERIAAIARVLSESDYDVIALQE
LWVSADYAHVRTALAKNLQHAKYFYSGALGSGLALFSRWPILATSVHPYSLNGSPIDVAG
GDWFVGKAAVSVLVEHPALGQLQIFNTHDLCQLFAKGGELGPEHLRAHRLINAYEIAKLI
RQAAQLGRNVIAMGDFNSTPQSLPVKIIMEHTGTHDAWLVTHPGDSGYSDNGAEHAVLHH
GITADSPLNTYADPAPKSEYVRQHRGKRLDYIFYRGPLQHPGTHVALPSEAQQGGTLPAA
SILDRATLRCASAQVLLTGLVPGRSHSYSDHFALEAIFEIVPTSISKSRTANTTTAQSWT
FSEDTGSLDSEDVWRGQPSNSKTPILSVESIDATIHALTTAYRHSLSTHRLYLVTFVCCI
GLLICIAIGTAWLPVPWVNPIFILATVAISWLGTTMLYIGFVYGRNIARVQVVTFRCPAV
TPSENDQFSPGMCGNATSEAYQDDASGEMPGFLALPSRPQRTQTIPVPTDASAPKPRPRK
ARSATLPTPSVLHELKVHGAMLRMMRAMGRHGKPVHVAVHDALRKNKGYELVLCGHSLGA
GVAALLSLVILGRPEDLPHSPLERPPGREKGVGLLLRAAVLDGRGAHGARCGHGHVLRVL
DVVSRLSLGSICDIRNAAMWLCDGQSRASSSKKGRGKGDEQTNNVGQRDTKGKGREKEAG
SLAPEVKESKGKGYKRVTKQGHEGKGQGERSGESRPEVKESKGKGYKRVTKLGAGRAEVD
HAVCHAILEALPSPSTIMWLDGKASLVKTLLWPVDDPFLTKHAGTRRRREGWSLMDDLVM
YWIAFLPSGDTEPARTIVYKADLVAVRNMQSQEVRLQQFVELNYVIHRLAVVPNLGFATA
EWKNATLHFRACNSSGALVREQEIPAQAAYGDLSIYQSTVSLCITSMEPPAPEWLDIPSH
VHYLRLDYLAGYTTDLPRDLAADTIATWNMEDGSLSMVKIPQTQLGRIEIVLASSLAFNP
KGAVLSSFSTAQDGAGQPLKFYEGQHTDPHSISNYLGHSSTAVARPIVVHNHDSGSRITV
FRSEILTGDIPSKATTRDPPGLREAFQYPNESRTLGFALSKGPSISGTRVLVHKMSHDGC
AAVYMLDFDQDLVASLLAKSDAERREWDVFLKANGSQIKIVTRRFYHSVDGEIYDQEYLW
PQEAPQEWQAHLDTIMKSDCRALNTMKRQRNIGVPCHLATCKLQFTWERA
NT seq 7893 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgctgacctctacaacctcgagttcctgtcgctcgttaacaagatcacacaa
gaaatcaacaatcacactggctacaatgacaaaacgctcgccgaattcgtcattgcgctc
catgacacctccaagaccctgccggagttcaagcagaaactgcaggaagccggcgccgac
ttccctgactccttcgtagaaaacattgaccgtctcattctcagcatgcacccgaggcac
aagaagaagtcgaaatcaaagaaggggaaggggaaatcgaaagaggccgatgtcaatggc
gtgaccgaactcgacgagctggacaagaaaaagcgcatgttccccgggctttccaaacct
gatcaggagtggcagccgtctgttaccaaggatgcgttgatgcaagaggttgatgatatg
atggctgccttcgaaggcggtgccaagaaggttagggcaagggagtcagacgaagagagg
tcgccgaagaggcaacgaagggagcatccgacatctcctcctcgtaggcgtagtccaagc
cctccacgtggccacccgtatgatgatggaggtcgaggtcggcattcccagcgcaatcga
caacaactcgacgagcgcccggtgctttataagatctacgatggccgagtgcaggggttg
aaggagtttggtgcctttgtccaactggaaggtgttgttggacgcgtagagggcctcgtt
catgtctccaacatacaaacaggcgcgcgcgcgaattcagcgtcagatttgctcagcaga
aaccaaccagtcaaggtcaaagtgatgagcgtcgcgggaagccgtgttggtttatccatg
aaggacgttgatcaagtcacgggcagggatctcaccccccacctacgaatcaaatccgag
gcagagttacttgaggaggagcggcagcacagtcgcctcgcctcatcgggagctaatgcc
attcctgtgggagggagggcatccagcggaataaacgaacctgtgcggtcagcgaagcgt
cttacctcccccgagcgctgggagatcaaacagcttatctcatccggggccatcgatcca
tcagagtacccggagctggacgaggacttctctaacaccatggcccgcgcagaggtcgag
gaggacattgacgttgaagtcagggaggaggagccggcatttctggctgggcaaacgaag
cggacactggatctcagtccggtgaagattgtgaaggcgcctgacggctctttgaataga
gctgctcttgctggcgcatcgcttgcaaaggaacggcgtgagctgcgacagcaagaagtg
aacgaacaagcggactcgcaagcccacgacttcagcgcaccatggttggaccctatgtcg
aaggagtcagaccgcgtcttcgcccaagacctgcgcggcaatctacgaggccaaaaggcg
ggtacagaggcgtcatggaagcaagcgaccttcaacaaagcgaccacattcggtgaaata
acaagcctcagcatccaagatcagcgcaagagcctgccaatttataaattacgagaccag
ctcattgaagccatcagggcgcatcaagtcctcatcgtggtcggtgacactggctcaggg
aagaccactcaaatggttcaataccttgccgaagaaggcttcgcagatcacgggaggatt
gggtgcactcagcctcgtcgcgtcgccgccatgtctgtcgcaaagcgtgtcgccgaggag
gtcggctgtcggttgggccaggaggtcggctatacgatccgtttcgaagactgcactagt
ccggagacgaagatcaagtacatgacggatggtatgctgcaacgagagtgcctcatcgat
cccaatgttagcgcgtacagcgtcatcatgttggatgaggctcacgaacggacgattgcc
accgatgtcctctttggtttattgaagagtgagtttgcgctccttcatgtcgaatactat
gtgctgacccctctcccagaggccatcaaacgccgcccggatctcaagttgatcgtgaca
tctgctactttggacgctgagaagttctcaaaatacttcttcggatgcccaatcttcacg
attcccggtcgaacatatcctgtcgagattctctacaccaaggagccggaatctgattat
ttggacgcctctctcatcacggttatgcagattcatctgtccgagccgaagggcgacatt
ctcctgttcctcacaggtcaagaagaaattgatactgcgtgcgagattctgtatgaacgc
atgaaggctctgggtcccaaggttccggagctcatcatccttcccatttactctgccctc
ccctctgaggttcaatcccgggttttcgagccaacaccagaaggagcgcgtaaagtcgtc
attgcaactaacgttgccgaaacgagcttaacgatcccgggcatctactacgttatcgat
cctgggttctccaagcagaacgcgtacgacccgcgcttgggtatggattcgctcgtggtc
atgccaatctctcaggcgcaagctcgacagcgagcgggacgtgctggtcgcaccggtccg
ggaaagtgttaccgcttgtatacagaagccgctttccggaacgagatgttaccgaattcc
atcccagacatacagcgaaccaatctggcacatacaatcctcatgctcaaggctatgggc
atcaacgatcttttgtcgtttgatttcatggacccgcctccagcccagaccatgctggaa
gcactgcaatcgctatattcgttatcagcccttgatgatgaaggtctgcttacacctctc
gggcggaagatggcagatttccccatggagccaaaggagtcgaagatgctgatcgcctcc
gttgaactaggatgttcggaggagatcctcagtatcgtcgccatgctttctgtgcagtcg
gtgttttaccgcccaaaggaaaagcagggccaagcagactccaagaaggccaaattccat
caacctgaaggcgaccatttaactctgctcgccgtttataacgggtggaaggcatcaaac
ttctcgaacccgtggtgttacgagaacttcattcaggcgcgaagcatgcggcgggcgcaa
gacgtgaggaagcagctcctaggcattatggaccggtacaagcatgacatcctgagcgca
ggcagagatttcaaccttgttcgccgcgccatttgctcagggttcttccgtaacgctgcg
aagaaagatccacaagaaggctacaagaccctcgtcgaaggcacacccgtttacattcat
ccgtcatctgctttattcaaccgcgcccctgagtggttggtttaccatgagctagtattg
actacgagggagtactgtcacaacgtgtgcgcggtggaggcgaaatggcttgtggaagct
gcaccgcagttcttcaaggttgcggacgcagcaaaactgaccaaacggaagaaacaagaa
aagattcagccgttgtacaacaaatacgaaaagccggacgaatggcggttgtcgaaattt
acattgtatattgataatgcgcccgctcatcctcatacgtgttttcgcgtcgttctggtc
aatgtcgacgatgaaggtggcatgccccaccaagctgcgttccatgttgcgacgtcgtcg
aggcaatgcggcagtgttaatggtggggtcgtccgcttggacgtagtacttggcaacctc
tcccgcttttgttgggggggcattggggtccggggtgagcatgaacgtctgagagaaaac
cctcgcttggccgtcgatggacttgctcggtgtggtggcagggttgccggaaggacctcg
accgtgtacgacggtcccagacaccgttacgagaagcgagggtggttgacttcctacggc
acatcaacaggtcatattagagcaacttgttgcgagacttcggagctcaccaggaatggg
atggcagtcaaaggattgtacttcatgtctcgtgctcggcatgctttcgatgagtttcct
catttcgtcagcgccttgaaaaggctttccattccagctgaccgtcgacgacgggcggta
gaagttggaatacatctggaggaagtcttaggtcgtacgcactcgtctttagtgagcatc
tttgaggaggaagatgactatacacgaggatcccaccttgccaatatgtcatcgaccctc
cgcgtctgtacgctcaactgctggggtctcaagttcgttgcaaaagaccgcaaagagcgc
atagcagcgatagctcgtgtgctcagcgaatctgactacgacgtgatcgctctgcaggag
ctatgggtctctgctgattacgcccacgtccgtaccgccctcgcgaagaatctacagcat
gcaaagtacttttatagtggggcactagggtcgggcctggcattgttctcccgctggcca
attctagcaacatctgtccatccatattcactcaacggctcgcctatcgacgtagccgga
ggagactggtttgttgggaaggctgctgtcagcgtactcgtcgaacatcccgcgctaggg
cagttgcagatattcaatacacatgatttatgccagctttttgctaaaggcggggaattg
ggccctgagcatcttcgggcacatcgtctgataaatgcatacgagatcgccaagctaata
agacaagctgcccagcttggccggaatgtcattgccatgggcgattttaatagtacgccg
cagtcgctcccagtgaaaatcatcatggaacacaccgggacgcacgacgcatggttggtg
acgcatccgggagacagtggttactcggacaatggagcagaacatgcagtcctgcaccac
ggaatcaccgctgattcccccctaaacacgtatgctgatccagctccgaaaagcgaatat
gttcgtcagcaccggggtaaacgcctagactacatcttctaccgcggacccctccagcat
ccgggcacgcacgtagcattaccttctgaagcccagcaaggagggaccctgccggctgca
tcaatacttgatcgggccacacttcgatgcgcgtccgctcaggtattgttgaccggactg
gtgcctggacgttcgcattcatactcagatcacttcgctcttgaagccatctttgagatc
gtacctacatctatctcgaagtcgaggacggctaataccacaacggcacagagctggact
ttttccgaagataccggtagcttggacagcgaggatgtctggcgcggacaaccgagtaat
tccaaaacgcctatcttgtcggttgagtctatcgatgcgacgattcacgctcttaccacc
gcgtatcggcattcactctctacgcatcgcctctacctcgtcacgtttgtctgttgtatt
ggtctactcatatgtatcgccatcggcacggcctggctgccggttccatgggtgaatccg
atcttcattcttgcaacggttgcgatcagttggctggggacgaccatgctatacattgga
tttgtgtacggcaggaacatagctcgcgtccaagtagtgacgttccgatgtccagcagtc
actcccagtgaaaacgaccaattttcacctgggatgtgcgggaatgcgacgtcggaagct
tatcaagatgacgcgtcaggcgagatgccggggttcttggccttgccttctcggccgcaa
cggacgcaaacgatccccgtcccaaccgatgcctctgcgcccaaaccacgccccagaaaa
gcgcgttctgccacgctacccaccccttccgttctgcacgaactcaaagtgcacggcgcg
atgctgcgcatgatgcgtgcgatgggcagacatggcaaaccggtacacgtcgccgtacac
gatgcgttgcggaagaacaaggggtacgagctcgtgctgtgcgggcacagtctcggcgcc
ggcgtcgctgcgcttctcagtctcgtaatcctgggcagacccgaagacttgcctcacagt
ccgctcgagcggcctcccggtcgggagaagggtgtcggtctactgcttcgcgccgccgtg
cttgacggacgaggcgctcacggtgctcgctgcggacatggtcacgtccttcgtgtactc
gacgtggtatcgaggctgtcgctgggctcgatctgcgacatccggaacgcggcgatgtgg
ttgtgcgatgggcagagtcgtgcttcgtcctccaagaagggtcgaggaaaaggggacgag
caaacaaacaacgtcgggcagagggacacgaagggaaagggcagggagaaagaagcgggg
agtctcgcgccggaggtgaaggagagcaagggcaagggctacaagcgcgtcacgaagcag
ggacacgaagggaaagggcagggagaaagaagcggggagtctcgcccggaggtgaaggag
agcaagggcaagggctacaagcgcgtcacgaagctcggagccgggcgcgccgaggttgac
cacgctgtttgccatgcgattcttgaggctctaccatcgccatcgaccatcatgtggttg
gacggaaaagcctcgttggtgaagacgctcttgtggccggtagacgaccctttcctgaca
aagcacgcggggacgcgccggcggcgagagggatggtcgttaatggacgatttggttatg
tattggatcgcctttctaccatccggggatacagagccagcgaggactatcgtttacaaa
gctgatttggtcgcggttcggaatatgcaatcgcaggaggttcgcttgcaacagttcgtc
gagctgaattatgtcatccatcgtttggccgtcgtaccaaaccttgggttcgccactgcc
gaatggaagaacgctaccctccacttccgggcgtgtaactcaagcggagctctcgtccgc
gagcaggagattccggctcaggcagcatacggagatttatcaatctaccaatctaccgtt
tccctgtgtatcacttcaatggaaccccctgctcctgagtggttggatattccttctcat
gttcactatcttcgtcttgattatctcgctggatatactaccgatttaccccgtgacctc
gctgcggacacgatcgccacctggaacatggaagacggctctttgagcatggttaagatc
cctcagacgcaactaggcagaattgagatcgtcttggccagcagtctcgcgttcaaccct
aagggagcggttctgtctagcttttcgacggcacaggacggcgctgggcaacctctgaaa
ttctatgaaggacagcacaccgatccgcactctataagcaactatcttggtcattcaagc
accgcggttgctcggcccatagtcgttcacaatcacgatagtggtagtcggattaccgtt
ttcagaagcgagatactaaccggggatataccgtcaaaggctacaacaagagatccacct
gggcttcgtgaagcctttcagtatcccaacgagtcccggacacttggatttgcgctttcg
aagggaccatctatctccggaacgcgtgtgctggtgcacaaaatgagtcatgacggatgc
gctgcggtgtacatgctggatttcgatcaggatcttgttgcatcgctgttggcgaagagc
gatgcggagaggagggagtgggatgtcttcctgaaggcgaacggaagtcagatcaagatc
gttacccggagattctatcacagcgtcgacggagaaatatacgaccaggagtacctttgg
cctcaggaagctccccaggaatggcaggcgcaccttgacaccattatgaagagcgactgt
cgggcgttgaatacgatgaagcgccagaggaacatcggagtcccatgccatttggctacg
tgcaaactgcaattcacctgggagagggcgtga

DBGET integrated database retrieval system