KEGG   Punctularia strigosozonata: PUNSTDRAFT_52933Help
Entry
PUNSTDRAFT_52933  CDS       T03131                                 

Definition
(RefSeq) NAD-aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
psq  Punctularia strigosozonata
Pathway
psq00010  Glycolysis / Gluconeogenesis
psq00053  Ascorbate and aldarate metabolism
psq00071  Fatty acid degradation
psq00280  Valine, leucine and isoleucine degradation
psq00310  Lysine degradation
psq00330  Arginine and proline metabolism
psq00340  Histidine metabolism
psq00380  Tryptophan metabolism
psq00410  beta-Alanine metabolism
psq00561  Glycerolipid metabolism
psq00620  Pyruvate metabolism
psq01100  Metabolic pathways
psq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PUNSTDRAFT_52933
   00053 Ascorbate and aldarate metabolism
    PUNSTDRAFT_52933
   00620 Pyruvate metabolism
    PUNSTDRAFT_52933
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PUNSTDRAFT_52933
   00561 Glycerolipid metabolism
    PUNSTDRAFT_52933
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PUNSTDRAFT_52933
   00310 Lysine degradation
    PUNSTDRAFT_52933
   00330 Arginine and proline metabolism
    PUNSTDRAFT_52933
   00340 Histidine metabolism
    PUNSTDRAFT_52933
   00380 Tryptophan metabolism
    PUNSTDRAFT_52933
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PUNSTDRAFT_52933
Enzymes [BR:psq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     PUNSTDRAFT_52933
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 18883600
NCBI-ProteinID: XP_007384528
JGI: 52933
Position
Unknown
AA seq 488 aa AA seqDB search
MASSSTLAFTPIEEIDRIHARLHAGFKTGTLKSLGKRQDQLLQLAYMLKENQSAFEEALA
KDLGRPKLETNFLEVAPLINEAVKTIKDVPKWAAPEKPPFNINFFAMKPVIRKEAKGVVL
IIAPFNYPYFLTIGPLIGAIAAGNACVVKPSELTPTCSQLMADLFPKYLDPDLYAVVNGA
IPETTRLLELKWDHILYTGNSRVAKIVAKAAAERLTPVSLELGGKSPVFVDPNCDLKMTA
RRLLWGKVANAGQTCVAPDYVLVPREFQDTLVKALEDTYKDFYPEGPAKSDSFSRIVSGN
HFNRIKKLLDGTQGQVVLGGDTNEGDRYIAPTVVKNVPTSDSLMSDEIFGPLLPIVPVKD
LDEAIAFVNSGDHPLALYVFSNDAKTKKKVFDSTQSGAACANELIIHIGAEGLPFGGIGP
SGTGYHTGKFTFDMFTHLRASIDSPGWIDMILNFRFPPYTAKKERALARMFPTKLPRRDA
YSSAKSQC
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcttcatctacgctcgccttcactcccattgaggagattgataggattcacgcc
cgcctccacgcgggtttcaaaaccggcaccctgaagtctctcggaaaacgccaagatcag
cttctgcagctcgcatacatgctcaaggagaaccaatcggcgtttgaggaggccttggcg
aaggatctcggtcgtccaaaactggagaccaacttcctggaggtcgctcccctgatcaac
gaagctgtcaagacgatcaaagacgtccctaaatgggccgcgccggaaaaaccgccgttc
aatatcaactttttcgctatgaaacccgtcatccgtaaggaggcaaagggcgttgttctg
atcatcgctccgttcaactacccatatttcctcaccatcgggccactcatcggcgcaatt
gcagcaggaaacgcatgcgtcgtcaaaccatccgagctcacgccgacctgctcgcagctg
atggctgatttgttcccaaaatatctggatccggacctgtacgccgttgtgaacggtgcc
atccccgagacgacccgtcttcttgaactgaagtgggaccacatcctgtacaccggtaac
agcagggtagcgaagatcgtggctaaagctgcggcggaacgtctcacgcccgtttcgctc
gagctgggtggaaagtcgcccgttttcgttgatcccaactgcgacctcaagatgaccgcg
cgaaggctgttatggggaaaagtggccaacgctggtcagacgtgcgtcgcgccagactac
gtcctcgtcccgcgcgagttccaggatacgctcgtcaaggcgctcgaggatacatataag
gatttctatcctgaaggacccgccaaatccgactccttctctcgtatcgtttccggaaat
catttcaatcggatcaagaagctcctcgacggcacccagggacaagtcgtgctcggtggc
gacacgaacgagggcgacaggtacatcgcaccgactgtcgtgaaaaatgtgcctacgtcc
gactcgctcatgtccgacgagatattcgggccactccttccgatcgttcctgtcaaggac
ttggatgaggccatcgctttcgtgaacagcggagaccatccgctggcgctctatgtgttc
tccaacgatgctaagaccaagaagaaggtgtttgacagtacgcagtcaggtgcagcatgc
gccaacgagctcatcatccatatcggagcggaaggcttgccattcggtggtattggaccg
agcggcactggctaccacacgggcaaattcaccttcgacatgttcacgcatctccgcgca
agcatcgactctcctggctggatcgacatgatcctcaacttccgattcccgccgtacacg
gcaaagaaggaacgggcgctcgcgcgcatgttcccgacgaaactgcctagacgcgacgcg
tactcgagcgcaaagtcgcagtgttag

DBGET integrated database retrieval system