KEGG   Punctularia strigosozonata: PUNSTDRAFT_74177Help
Entry
PUNSTDRAFT_74177  CDS       T03131                                 

Definition
(RefSeq) beta-glucosidase
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
psq  Punctularia strigosozonata
Pathway
psq00460  Cyanoamino acid metabolism
psq00500  Starch and sucrose metabolism
psq01100  Metabolic pathways
psq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PUNSTDRAFT_74177
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    PUNSTDRAFT_74177
Enzymes [BR:psq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     PUNSTDRAFT_74177
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_3_C Glyco_hydro_3 Fn3-like Ser_hydrolase
Motif
Other DBs
NCBI-GeneID: 18885484
NCBI-ProteinID: XP_007386956
JGI: 74177
Position
Unknown
AA seq 778 aa AA seqDB search
MFLPYPSPTPATPDSEFIPVTPANPLPVQDPLNGPWLVPDFTEAWNAAWEKAQAFIANLT
LEEKVNVTTGVGWMKGRCVGHIPPVGSFPGLCLEDSPLGVRFADYVTAFPSGLNTAATWN
RTLMRLRGSAMGSEFRAKGVHAALGPMMNIMRVPQGGRVWEGFGADPFLAGEAAYETILG
MQSVGVQAVAKHYINNEQEHARTMSSSNVDDRTEHEIYVHPFLRSVMAGVASVMCSYNLI
NGTYACSNDKTLNGILKDELGFRGYVQSDWQATHATLDSMMGLDMTMPGDVTFGSGDSFF
GGNMTAYVQNGTIPEAKVDDMATRILAAWYLLEQDEGYPDVNFNAWNLQDPLTNEHVNAQ
EDHMDVVRAIGAASTVLLKNANETLPLKKPRSVAVIGSDAGPQRNGPNEFADRGGVDGVL
AMGWGSGTCEFPYLVSPLESLQARARHDRAIFTWFLNDYDLVGAATAAIGRDVALVFINA
DSGEDYITVDGNEGDRFNLTAWHNGDELILAVAAQNNNTVVVAHSVGPLIVEPWIDHPNV
TALIWAGIPGQEAGNSLVDVLYGDVNPSGRLPYTIAKNASDYPASLVLGGGSEDILSITY
NEGLLVDYRAFDALGRTPRFEFGFGLSYTQFEYDNLTIFKIEDEDVPELHGLEESWEGDK
PSPSGYGSSVSLWLHRPAYSVNFDVRNVGERFGGEIPQVYLHFPSDSGEPPAVLKGFTDV
VLRPGESKRVTVNLSRYDLSVWDVPMQAWQRPKGDIGVTVGASSRDGRLTGVIEADDD
NT seq 2337 nt NT seq  +upstreamnt  +downstreamnt
atgttcttgccgtatccgtcgccgacgcctgccacacccgactccgaattcatcccagtc
acacctgccaatccgctgcccgtacaagatccgctgaacgggccatggctcgtgccggac
ttcaccgaggcgtggaatgcagcgtgggagaaggcgcaggcgttcatcgcgaacctgacg
ttggaggagaaggtaaacgtgacgacgggagtggggtggatgaaagggcgatgcgttggc
catatacccccggtcgggtccttccccggtctatgcctcgaagactccccgctcggcgta
cgcttcgcggactacgtgaccgcgttcccatcgggccttaataccgccgcgacgtggaac
cgaacgctcatgcgtctccgcggatccgcaatgggctctgagttccgggcgaagggggtg
catgcggctttgggtccaatgatgaacatcatgcgtgtcccgcaaggcgggcgggtgtgg
gagggcttcggcgcggacccgttcctcgcgggtgaagctgcgtacgagacgatcttggga
atgcagagtgttggtgtacaggctgtcgcgaagcactatatcaacaacgagcaagagcac
gcgagaacgatgagcagttcgaacgtcgacgaccggacggagcatgagatttacgtgcat
cccttcttgaggagcgtgatggccggcgttgcgagtgtcatgtgcagctacaatctcatc
aatgggacgtacgcttgcagcaacgacaaaacgctcaatggcatcctcaaggatgagctt
ggattccgcggctacgtccagagcgactggcaggctacacacgcaacccttgactccatg
atgggattggacatgaccatgcctggcgacgtcacgttcggatccggagacagtttcttc
ggcggcaacatgaccgcgtacgttcagaacgggacgatcccagaagcgaaagtcgacgac
atggccactcgcatactcgcggcatggtacctccttgaacaagacgagggatatcctgac
gtcaattttaatgcctggaacctccaagatccgctgaccaatgaacacgtcaacgcgcag
gaggaccacatggacgttgtacgtgccatcggggcagcgagcacggtcctgctcaagaac
gcgaacgagacgttgccgttgaagaaacctcggagcgtcgcggtcatcggctctgacgca
ggaccgcagcggaacggcccgaacgaatttgcggatcgtggtggtgtagatggcgtgttg
gccatgggttggggctctggtacatgcgagttcccgtatctcgtgtcgccgttggagtca
ctccaagcccgcgcccgtcatgaccgtgctatattcacctggttcttgaacgattacgac
ctggtgggcgctgcgacggctgctataggtcgcgatgtcgcccttgtgtttataaatgct
gatagtggggaggactatatcaccgttgacggcaacgagggagatcggttcaaccttaca
gcctggcacaacggcgacgagctgatccttgccgtcgccgcacagaacaacaataccgtg
gtcgtcgcacacagcgtaggaccgctgattgtcgagccgtggatcgatcatccgaacgtg
acggctttaatatgggctggcatccccggccaggaagctggcaacagtctcgtcgacgtc
ctgtacggcgacgtcaacccgtccggcaggctaccgtataccatcgccaagaacgcgtcc
gactatcccgcctcgctcgtcctcggtggcggttcggaggacatcctcagcattacatat
aacgaaggtcttctggtagactaccgcgcgttcgacgccttaggacgaacaccgcgattc
gagttcggcttcggcttgagctacacgcaatttgagtacgataacctaaccatcttcaag
attgaggacgaggatgtgccggagttgcacgggctcgaggaatcctgggagggagacaag
ccgtctccgagcggttatgggtcttcggtgtccctatggctccatcgcccagcgtacagc
gtcaacttcgacgtccgtaatgtcggcgagaggttcggtggcgaaatcccacaggtctac
ttgcacttcccgtcggacagtggcgagccgccggccgtgctgaagggttttaccgatgtg
gtgcttcgtccaggcgagagcaaacgcgtcaccgtgaacctctctcggtacgacctgtct
gtgtgggacgtccccatgcaggcatggcagcgcccgaagggcgacatcggggtgacggtt
ggcgcaagcagccgggacgggcggctgaccggcgttatcgaggcagacgacgactga

DBGET integrated database retrieval system