KEGG   Punctularia strigosozonata: PUNSTDRAFT_82296Help
Entry
PUNSTDRAFT_82296  CDS       T03131                                 

Definition
(RefSeq) hypothetical protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
psq  Punctularia strigosozonata
Pathway
psq00052  Galactose metabolism
psq00500  Starch and sucrose metabolism
psq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    PUNSTDRAFT_82296
   00500 Starch and sucrose metabolism
    PUNSTDRAFT_82296
Enzymes [BR:psq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     PUNSTDRAFT_82296
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 18886037
NCBI-ProteinID: XP_007380418
JGI: 82296
Position
Unknown
AA seq 545 aa AA seqDB search
MKFVDVVVAGGTLFGLAAAQGSLSVREASVSTAAPIPGNYTGVLRPQIHFSPPQQFMNDP
NGCFLDSNGTWHLYYQYNPTDLVAGNQHWGHATSTDLYHWINQPIAISPPDGDSQVFSGS
AVVDVNNTSGFFPDQDNGVVAIYTLNTPTAQIQEISYSRDGGYTFEAFEGNPVINSTSLQ
FRDPKVIWFKDHWVMVVAYSQDFAIGIFTSPDLKEWTHASNFTHRGLLGLQYECPNLVEV
PVNGTDDTMYLLAISINPGAPLGGSITEYFPGTFNGTHFTPVDDAARMADFSKDNYAGQF
FYGTPKGQDAVSIAWASNWQYAQMVPTATEGWRSAMSLPRRNFLTNITRLGWDLVSVPYD
LSPILGDVLASNDSLGNGTIEVNYTSVESNALYFEANVTGLASSAISASATLNFTFSSLD
TGERLSGGYYFGNDNAFFLDRGQTRGFDNPFFTDKFSTSDLLDPSGTWSVSGVIDRSIFE
VFLDRGTYSATTTFFPTQPLTLFTLKTADLPEGAVVSVVVRAVQSAWAREADAQGTVLGN
VSATA
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcgtcgatgtcgtcgtagctggaggaacgctattcgggcttgcagctgcccaa
ggctctctatcagtgcgtgaagcatcggtttcaactgctgcgccgataccgggcaactac
acgggggtcttgcggcctcagatccacttttcaccgcctcagcaattcatgaatgatccc
aatggatgcttcctcgattcgaatggaacgtggcatctctactatcaatacaatcctaca
gatctggtcgcggggaaccagcattggggtcatgccactagcacggacctgtatcactgg
atcaaccaacctatcgccatttctccgcccgacggtgactctcaggtgttcagtggttcc
gcggttgtggacgtcaacaatacgtccggcttctttccggatcaggataacggtgttgtg
gctatatacaccttgaacacgcctacggcacaaatccaagagatctcgtactcacgcgat
ggtggctacaccttcgaggccttcgagggcaatcctgttatcaatagcacctccctccaa
ttccgggatcccaaggtcatctggttcaaggatcactgggttatggtcgtcgcgtactcg
caagacttcgcgatcgggatcttcacttcgcctgatctgaaggaatggacacatgcttcc
aacttcacgcatcgtggtctactcggcctccaatacgagtgcccgaacctggtggaggta
cccgtgaatggcaccgacgacacgatgtacctcctggctattagcatcaacccgggtgca
cctctcggtgggagcatcacggaatactttcccggcaccttcaatggaacgcatttcacc
cctgttgatgatgcggctcgcatggccgatttctcgaaggacaactacgccggccagttc
ttctacggcacgccgaaagggcaggatgccgtttccatcgcttgggctagcaactggcag
tacgcacagatggtgccgacggctaccgagggctggcggagcgcgatgtcgctgccgcgc
cgcaacttcctgacgaacatcacccgtctgggttgggatctggtgtccgtcccctacgac
ctcagccccattcttggggacgtgctcgcgagcaacgattccctcggcaatggaaccatc
gaggtcaactacacttccgtggagtctaacgccctctactttgaggcgaacgtcaccggg
ctggcatcaagcgcaatctccgcctctgcgacccttaacttcacattctcttcccttgac
acaggagagcgcctgtccggaggttattacttcggaaacgataacgctttcttcctcgac
agaggccagacgcgaggcttcgataaccccttcttcacggacaagttttcgacttcagat
ctcctcgatccgagtggcacatggagcgtgtcgggagtaatcgataggagtatcttcgag
gtgttcttggaccgcggcacgtatagtgctacgacgaccttcttccccacccagccgttg
acgctgttcacgctgaagaccgctgatttaccggagggagcagtggtcagcgttgtggtt
cgcgcggtgcagagcgcttgggctagagaagcggacgctcagggaacggtgcttgggaat
gttagcgcgaccgcataa

DBGET integrated database retrieval system