KEGG   Punctularia strigosozonata: PUNSTDRAFT_89180Help
Entry
PUNSTDRAFT_89180  CDS       T03131                                 

Definition
(RefSeq) cellobiohydrolaseII
  KO
K19668  cellulose 1,4-beta-cellobiosidase [EC:3.2.1.91]
Organism
psq  Punctularia strigosozonata
Pathway
psq00500  Starch and sucrose metabolism
psq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PUNSTDRAFT_89180
Enzymes [BR:psq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.91  cellulose 1,4-beta-cellobiosidase (non-reducing end)
     PUNSTDRAFT_89180
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_6 CBM_1
Motif
Other DBs
NCBI-GeneID: 18886352
NCBI-ProteinID: XP_007385391
JGI: 89180
Position
Unknown
AA seq 447 aa AA seqDB search
MFKYAALLAFVSVVTAQSQLYGQCGGIGWTGSTTCVAGATCTVLNDYYSQCLPGAASSSS
TPTTVSSSHSTTTASSTGTSSAPTSTATPAAGNPFEGYTIYLSPYYANEIALAAGNITDS
TLKAKAASIANIPTFTWLDTVAKVPDLGTYLADADSIQKSTGQKQLVQIVVYDLPDRDCA
AKASNGEFSIADNGQANYFNYMDQIVAQIQKYPDVRVVAVIEPDSLANLVTNLNVQKCAN
AETTYKACVTYALKQLSSVGVYQYMDAGHAGWLGWPANISPAATLFTQMYQAGGSSPFIR
GLATNVANYNALTAASPDPITQGNPNYDESHYINALAPMLASSGFPAQFIVDQGRSGVQN
IRQQWGDWCNIKGAGFGTRPTTNTGNSYIDSIVWVKPGGECDGTSNSSSPRYDSTCSLSD
ADQPAPEAGTWFQEYFQTLVSKASPSL
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaatacgccgcactccttgctttcgtgtctgtggtgactgcgcagtcgcagctc
tacggacaatgcggtggaattggctggacaggctcgacaacctgcgttgccggcgctacc
tgcacggtactcaacgactactactctcagtgcttgcctggggccgccagcagcagcagc
acgcccacgaccgtctcttcgagtcactccaccacgaccgcctcgtctaccggcacgagc
agcgctcctacgtctaccgcgaccccagcggctggtaaccccttcgaaggctacacgatc
tacctcagcccttattacgccaatgagatcgcccttgctgcaggcaacatcaccgactcg
acattaaaggccaaggctgcgagtatcgccaatatcccgacttttacctggttggacact
gtcgccaaggttcctgatcttggcacctaccttgcggacgccgactctatccagaagagc
actggccaaaagcaactcgtgcaaatcgtggtttacgacctgcccgaccgcgactgcgct
gccaaggcatccaacggagagttcagcatcgccgacaacggccaggccaactacttcaac
tacatggaccagatcgttgctcagattcagaaataccctgatgtccgcgttgttgccgtc
atcgagcctgattcgctagcaaacttggtcaccaacctgaacgtccagaagtgcgccaac
gccgagacgacctacaaggcatgcgtcacttacgctctcaagcaactctcgagcgtcggc
gtgtaccagtacatggatgccggtcacgctggctggctcggctggcctgctaacatctcc
cccgcggccaccctgttcacccagatgtaccaggctggcggatcctcgcctttcatccgc
ggtcttgctactaatgtcgccaactacaacgcgctcaccgcggcaagccccgacccgatc
acccaaggcaaccccaattacgacgagtcgcactacatcaacgctctcgcgcccatgctc
gcgtcgtcgggcttccccgcgcaattcatcgtcgaccagggccgctctggtgtccagaac
atccgccaacagtggggtgactggtgcaacatcaagggtgccggctttggtactcgccca
acgaccaacactggtaactcgtacatcgactcaatcgtgtgggtgaagcccggaggcgag
tgcgatggtactagcaacagctcctccccgcgttacgacagcacatgttcgctctcggac
gccgaccagcctgcgcctgaggctggcacatggttccaggagtacttccagaccttggtc
agcaaggccagcccttccctctaa

DBGET integrated database retrieval system