KEGG   Punctularia strigosozonata: PUNSTDRAFT_98111
Entry
PUNSTDRAFT_98111  CDS       T03131                                 

Definition
(RefSeq) nitrite reductase
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
psq  Punctularia strigosozonata
Pathway
psq00910  Nitrogen metabolism
psq01100  Metabolic pathways
Module
psq_M00531  Assimilatory nitrate reduction, nitrate => ammonia
psq_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:psq00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    PUNSTDRAFT_98111
Enzymes [BR:psq01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     PUNSTDRAFT_98111
SSDB
Motif
Pfam: Pyr_redox_2 Rieske_2 NIR_SIR Pyr_redox Fer2_BFD NIR_SIR_ferr Rieske K_oxygenase AlaDh_PNT_C
Other DBs
NCBI-GeneID: 18886918
NCBI-ProteinID: XP_007380627
JGI: 98111
Position
Unknown
AA seq 1129 aa
MDASTTTAKTDAAERKTVVVVGLGMVGIAFIEKLLDLDEAHKYKIVTCGEETHIAYNRVA
LTEYFQHRSIEKLYLNGPEWYAKQSPDRFEFHVGEAVTTLDHASHTVSTSIGRTIRYDYC
VLATGSEATIPSYCKPDMQGVFVYRNIADLEKIMAYADRDNVRGGKAVVVGGGLLGLEAA
KAVYDLETIKDVSIVNRQAFPLSRQLDAGGGEIVLRRIEAMGVDVLTNTSVKSIIASPDD
PNVFAGLELMDGRTLDAHLVIFAIGITPRDDLARKSGLACEERGGITVNDSLETSAKDVY
AIGECASWQHNTYGLIAPGIEMADILSFNLTQLATAVGGFKPRQMNNPDLSTKLKLMGVD
VASFGDFFREKREFEKKRRPRIPSPKAETMTLPSKAETEEKPPVWNVTEDRTKTAPAQKP
LSDASAPKKRHGAAAAMEGPIETLTYRDPFAGVYKKYIFTADGKYVLGGMMVDDTSDYVK
LVALVKKKKALEIPPGQFIGGGAKSDESGADLDDDTQICSCHNVSKGQVAQCVRDGCDNI
GDLKAKTKAGTGCGGCMPLVTNIFKAEMEKAGHAVNNNICPHFAMSRAELFNVVQIKKLK
TFTAIMEDCGVNMDALGCETCKPVIGSILSSLWNEHVMNPAHHQNQDTNDRFMANIQRNG
TFSVIPRVAAGEITPDKLIVLGQVAKKYGLYTKITGGQRVDLFGAQKADLPDIWEELVNA
GFESGHAYGKSLRTVKSCVGTSWCRYGVGDSVGMAIHLEDRYKGIRSPHKLKGGVSGCVR
ECAEAQNKDFGLIATDKGWNLFLCGNGGAVPKHAQLFAQDVPPSRVVRIIDRFIIYYIRT
ADKLMRTARWIEQMEGGLDRLKKIIIDDELGICADLDREMDELVGTYYDEWKAVVQDPVR
RKQFRQFVNTDERKPQIEEIIERGQPRPANWAKVFPPVKLTESDIRTPKEQWTWRPLAKV
SDLMPTDAGTTSAAVKYGDTQIAIYCVPKRGFFATQQMCPHKRAFVLDHGIIGDDPKTGT
AYVSCPLHKRNFALKSGACLNDDEYSILSFDVKVEGDGDTAVLSLLLPEPEELDAVIGSN
KWMVRQATAELLDRGAGEGNGIQIVGPEDMGEHGSSSNVSLCANTQLEW
NT seq 3390 nt   +upstreamnt  +downstreamnt
atggacgctagcaccacaactgccaagaccgatgctgccgagcgcaagacggtcgtcgtc
gttggcctcggaatggtaggcatcgccttcatcgagaaactactcgacctcgacgaagcc
cacaagtacaagatcgtcacctgcggcgaggaaacgcacatcgcatacaatcgggtcgcc
cttaccgagtacttccagcaccgttcgatcgagaagttgtatctgaacgggcccgagtgg
tatgcgaagcagtcgccggatcgtttcgagttccacgttggtgaggccgtgaccacgctt
gatcacgcttcccataccgtctcgacgagcatcggtcgaaccatccgatatgactactgc
gtccttgcgacgggctcggaggcgacgatcccgagctactgcaagcccgacatgcagggc
gtgtttgtataccgcaacatcgccgatttggaaaagattatggcatacgccgaccgggac
aacgtacgcggtggaaaggccgtggtggtcggcggtggtttgctcggtttggaggcagcc
aaagccgtgtacgacctggagacgatcaaggatgtctcaatcgtcaaccgccaagcattc
cccctctcccgccagcttgacgctgggggcggcgaaatcgtcctccgccgcatcgaagcc
atgggcgtcgacgttctcaccaacacctccgtcaaatccatcatcgcctcgccagacgac
ccgaacgtattcgctggccttgagctgatggacggcagaactctggacgcgcatctcgtc
atcttcgccattggcatcacacctcgtgacgatctcgccaggaagtcagggctcgcgtgc
gaggaacgcggtggtatcaccgtgaatgactccctggagaccagcgcgaaggacgtgtac
gctatcggcgagtgcgcgagctggcagcacaacacatacggcctcatcgcccccggaatc
gaaatggccgacatcctgtctttcaaccttacgcaactggcaactgctgtcggcggcttc
aaaccccgccagatgaacaaccccgatctgtccaccaagctgaagctcatgggcgtcgac
gtcgcttccttcggtgacttcttccgcgaaaaacgcgagttcgagaagaagcgccgtccc
aggattccctcgcccaaagctgagactatgaccctgccgtcaaaggcagagacagaggag
aaaccgccggtatggaacgtgaccgaggaccggaccaagacagcccctgcacaaaagccg
ctcagcgacgcctctgcgccgaagaagaggcacggggcggcagccgccatggagggcccg
atcgagacgctgacctaccgcgacccattcgcgggtgtgtacaagaaatacattttcacc
gcggacggaaaatacgtcctgggtggtatgatggtggacgacacgtcggattatgtcaag
ctagtcgcgctcgtcaagaagaagaaggcgctcgagatccctcctggccagttcatcggc
ggaggggcgaaatcggacgaaagcggtgccgatctcgacgacgacacgcaaatctgcagt
tgtcataacgtgtcgaaaggccaagtggcgcaatgcgtgcgagacgggtgcgataatatc
ggagatctgaaggccaagacgaaggccggtaccgggtgcggcggttgcatgccgctcgtg
acgaacatcttcaaggccgagatggagaaggccggccacgccgttaacaacaatatctgc
ccgcacttcgccatgtcgcgggccgaacttttcaacgtcgtacagatcaagaagctcaag
accttcaccgccatcatggaggactgcggtgtcaacatggacgcgttgggatgcgaaacg
tgcaagccggtcatcggcagtatcctgtcctcgctatggaacgaacacgtcatgaacccg
gcgcaccatcagaatcaggacacgaacgatagattcatggccaacatacagcggaacggc
actttctctgtcatccctcgtgttgcagctggggagatcaccccggacaagctgatcgta
ctcggccaagtggcgaagaagtatggattgtacacgaagataactggaggtcaacgggtg
gacctgtttggcgctcagaaggcagatctccctgacatatgggaagagctcgtgaacgcc
ggctttgagagcgggcacgcttatggcaaatcgctgaggactgtcaaatcttgcgtaggc
accagttggtgtcgttacggcgttggtgactctgtcggcatggccatacatctcgaagat
cgttacaagggcatccgctctcctcacaagctcaagggaggagtgagcggctgcgttcga
gagtgtgctgaggcccagaacaaggacttcggactcatcgcgacagacaaaggctggaac
ctcttcctttgcggaaacggtggcgcagttcccaaacatgcccaactctttgcgcaggac
gttccgccgtccagagtggttcggatcatcgaccgcttcatcatctactacatcaggacc
gcggacaagcttatgcgaacagcgagatggatcgagcagatggaaggcggcctcgatcgc
ctgaagaagatcatcatcgacgacgaactcggcatctgtgccgatctcgaccgtgagatg
gacgagctcgtcggcacgtactatgacgagtggaaggcagtcgtccaggacccggtcagg
cggaagcagttccgtcagtttgtcaacacggacgaacgaaagccgcagattgaggagatc
atcgagcggggccaacctcgaccggcgaactgggcgaaggtgttccctccggtcaaactc
acagagtcggacatccggacgccgaaagagcagtggacatggcggccgttggccaaggtt
tccgacctgatgccgaccgatgcggggactacttctgctgctgtcaagtatggcgatacc
cagattgctatctattgcgttccgaagaggggattcttcgcgacgcagcagatgtgccct
cacaagcgagcgttcgtcctggatcacggtatcatcggcgatgatccgaagactggtaca
gcatatgtatcctgtccattacacaaacgcaactttgcactgaaatcaggggcatgcctc
aacgacgatgagtatagcatccttagcttcgacgtcaaagtcgagggcgatggagatacg
gcggtgttatcccttctgctcccggagccagaggagctcgacgctgtgattgggtcaaac
aaatggatggtgcggcaagcgacggcggagctcctcgaccgaggtgctggggaaggcaac
ggcatccagatagtgggtcccgaggacatgggcgaacatgggtcgtcaagcaacgtctcg
ttatgcgccaacacccaactagagtggtaa

DBGET integrated database retrieval system