KEGG   Pseudomonas stutzeri DSM 4166: PSTAA_0248Help
Entry
PSTAA_0248        CDS       T01976                                 

Gene name
accC-2
Definition
(GenBank) acetyl-CoA carboxylase subunit A
  KO
K01959  pyruvate carboxylase subunit A [EC:6.4.1.1]
Organism
psr  Pseudomonas stutzeri DSM 4166
Pathway
psr00020  Citrate cycle (TCA cycle)
psr00620  Pyruvate metabolism
psr01100  Metabolic pathways
psr01120  Microbial metabolism in diverse environments
psr01200  Carbon metabolism
psr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:psr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PSTAA_0248 (accC-2)
   00620 Pyruvate metabolism
    PSTAA_0248 (accC-2)
Enzymes [BR:psr01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     PSTAA_0248 (accC-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp ATP-grasp_3 RimK ATP-grasp_4 AP_endonuc_2 ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: AEA82169
Position
277313..278728
Genome map
AA seq 471 aa AA seqDB search
MIKKLLIANRGEIAVRIVRACAEMGVRSVAVFSEADRHALHVKRADEAYFIGEDPLAGYL
NPRKLVNLAVETGCDALHPGYGFLSENAELAEICAERGIKFVGPSADVIRRMGDKTEARR
SMIKAGVPVTPGTEGNVKDLAEALREAERIGYPVMLKATSGGGGRGIRRCNSQAELESAY
PRVISEATKAFGSAEVFLEKCIVEPKHIEAQVLADSFGNTVHLFERDCSIQRRNQKLIEI
APSPQLTPEQRAYIGDLAVRAAKAVGYENAGTVEFLLADGEVYFMEMNTRVQVEHTITEE
ITGIDIVREQIRIASGQPLSVKQEDIQHRGFSLQFRINAEDPRNNFLPCFGKITRYYAPG
GPGVRTDTAIYTGYTIPPYYDSMCLKLVVWALTWEEALARGSRALDDMRVQGVKTTATYY
QQILANPDFRSGQFNTSFVDNHPELLNYSIKRKPGELALAIAAAIAAHAGL
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgatcaagaagctgctgatcgccaaccgcggggaaatcgcggtgcgcatcgtccgcgcc
tgtgccgaaatgggcgtccgctcggtggcggtgttctccgaagccgaccgccatgcgctg
cacgtcaagcgcgccgacgaggcctatttcatcggcgaggacccgctggccggctacctg
aacccgcgcaagctggtgaacctggcggtagagaccggctgcgatgccctgcatcccggc
tatggattcctctccgaaaacgccgaactggcggaaatctgcgccgagcgcgggatcaag
ttcgtcgggccttcggcagacgtgattcgccgcatgggcgacaagaccgaagcccgtcgc
agcatgatcaaggccggcgtgccggtcacgccgggcaccgaaggcaacgtcaaggacctc
gccgaggcgctgcgcgaagccgagcgcatcggttatccggtgatgctcaaggccacctcc
ggtggtggtggccgcggcattcgtcgctgcaactcgcaggcagagctcgagtcggcttac
ccgcgggtgatctccgaagcgaccaaggccttcggcagtgccgaggtgttcctggaaaag
tgcatcgtcgagcccaagcacatcgaggcgcaggtgctggctgacagtttcggcaacacc
gtgcacctgttcgagcgtgactgctcgatccagcggcgcaaccagaagctcatcgagatc
gcccccagcccgcagctcacccccgagcagcgcgcctatatcggcgacctggcggtgcgt
gccgccaaggcggtgggttacgagaacgccggtaccgtggagttcctgctcgccgatggc
gaggtgtacttcatggagatgaacacccgggtgcaggtggagcacaccatcaccgaggaa
atcaccggcatcgacatcgtgcgcgagcagatccgcatcgcttcgggccagccgctgtcg
gtcaagcaggaagacatccagcatcgcggcttctccctgcagttccgcatcaacgctgag
gacccgcgcaacaacttcctgccctgcttcggcaagatcacccgttactacgctcccggc
gggccgggcgtgcgcaccgacacggcgatctacaccggttacaccattccaccgtattac
gactccatgtgcctgaagctggtggtctgggcgctgacctgggaagaggcgctggcccgc
ggctcgcgcgcgctggacgacatgcgcgtgcagggcgtgaagaccactgccacctactac
cagcagattctcgccaatccggatttccgcagcggccagttcaataccagcttcgtcgac
aaccatccggaactgctgaactactcgatcaaacgcaagccgggcgaactggccctggcc
attgccgccgccatcgccgcccacgcaggcctgtga

DBGET integrated database retrieval system