KEGG   Pseudomonas stutzeri DSM 4166: PSTAA_0488Help
Entry
PSTAA_0488        CDS       T01976                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
psr  Pseudomonas stutzeri DSM 4166
Pathway
psr00620  Pyruvate metabolism
psr00630  Glyoxylate and dicarboxylate metabolism
psr01100  Metabolic pathways
psr01110  Biosynthesis of secondary metabolites
psr01120  Microbial metabolism in diverse environments
psr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:psr00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PSTAA_0488
   00630 Glyoxylate and dicarboxylate metabolism
    PSTAA_0488
Enzymes [BR:psr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     PSTAA_0488
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: AEA82408
UniProt: F2MWJ1
Position
538429..540609
Genome map
AA seq 726 aa AA seqDB search
MTERVTLGRLQVAANLQRFIEDEVLPGTGIEAAAFWQGFDALVHDLAPKNRELLAERDRM
QVELDSWHKANSGPIKDMVAYRAFLESIGYLLPVPGEVKIETANVDSEIATQAGPQLVVP
IMNARYALNAANARWGSLYDALYGTDAISEEGGAQKGPGYNEVRGAKVIAYARTFLDQAA
PLSEGSHADATAYRVQDGQLKVTLENGSVTGLKQPEKFVGFQGEAVEPKAVLLKNNGLHI
EIQIDPNSPIGQTDAAGVKDLLIESAVSTILDCEDSVAAVDADDKVLAYRNWLGIVQGTL
SEEVAKGSSSFVRRLNPDREYSAPNGGELKLHGRSLLFIRNVGHLMTNPAILLEDGREIP
EGIMDGVFTSLIAKHDLARKGNSRTGSVYIVKPKMHGPKEVAFADELFGRVEDLIGVPRY
TLKMGIMDEERRTSANLKACIAAAKHRVAFINTGFLDRTGDEMHTCMEAGPVLRKGDMKS
TPWIQSYERNNVLVGLACGLRGKAQIGKGMWAMPDLMAAMLEQKIGHPKSGANTAWVPSP
TGATLHALHYHQVNVQAVQSELEKVDLAAEREQLLNDLLTIPVVAEDKWSAEEKQQELDN
NCQGILGYVVRWVEQGVGCSKVPDIHNVGLMEDRATLRISSQHIANWLHHGVVSREQVQE
TLERMAKVVDQQNAGDPLYRAMSSDYTQSIAFQAASDLVFKGREQPSGYTEPLLHQWRQR
FKAAQS
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgactgagcgtgtaaccctgggccgcctgcaagttgcggccaatctgcagcgtttcatc
gaagacgaagtcctgccgggcaccggtatcgaagccgccgccttctggcagggcttcgac
gccctggtccatgacctggcgccgaagaaccgtgagctgcttgccgagcgcgaccgcatg
caggtcgagctggacagctggcacaaggccaactcaggcccgatcaaggacatggtggcc
taccgcgcgttcctcgaatccatcggctacctgctgccggtgccgggcgaggtgaagatc
gaaaccgccaacgtcgacagcgagatcgccacccaggccggtccgcagctggtggtgccg
atcatgaacgcccgctatgcattgaacgccgccaacgctcgttggggctcgctgtacgac
gcgctctacggcaccgacgccatctccgaagagggcggtgcgcagaagggcccgggctac
aacgaagtccgtggcgccaaggtcatcgcctatgcgcgcaccttcctcgatcaggccgcg
ccgctgtccgaaggcagccacgccgacgccaccgcctatcgcgtgcaggacggccagctg
aaggtcaccctggagaacggcagtgtcaccggcctcaagcagccagagaagttcgtcggc
ttccagggcgaagcggtcgagccgaaggccgtgctgctgaagaacaacggcctgcacatc
gagatccagatcgacccgaacagcccgatcggccagaccgatgccgccggcgtgaaggac
ctgctgatcgagtccgcggtttccaccattctcgactgcgaagattcggtcgccgcggtg
gatgccgacgacaaggtgctggcctaccgcaactggctgggcatcgtgcagggtaccctc
agcgaggaagtggccaagggcagctcgagcttcgtccgccgcctgaatccggaccgcgaa
tacagcgcgcccaacggcggcgagctgaagctgcacggccgctcgctgctgttcattcgc
aacgtcgggcacctgatgaccaacccggcgatcctgctggaagacggccgcgagattccc
gaagggatcatggacggcgtgttcaccagcctgatcgccaagcatgatctggcgcgcaag
ggcaactcgcgcaccggcagcgtctacatcgtcaagccgaagatgcacgggccgaaggaa
gtcgccttcgccgacgaattgttcggtcgcgtcgaggacctcatcggtgtgccgcgctac
accctgaagatgggcatcatggacgaggagcgccgtaccagcgccaacctcaaggcctgc
atcgccgcggccaagcaccgcgtggcgttcatcaacacgggcttccttgaccgtaccggc
gacgagatgcacacctgcatggaagccgggccggtgctgcgcaagggcgacatgaaatcc
accccgtggatccagtcctacgagcgcaacaacgtactggtcggcctggcctgcggcctg
cgcggcaaggcgcagatcggcaagggcatgtgggccatgccggacctgatggcggccatg
ctcgagcagaagatcggccatccgaagtccggcgccaacaccgcctgggtgccttcgccc
accggcgccaccctgcatgcgctgcattaccaccaggtgaacgtgcaggccgtgcaaagc
gagctggaaaaggtcgacctggccgccgagcgcgagcagctgctcaacgatctgctgacc
atcccggtggtcgccgaagacaagtggagcgcggaggagaagcagcaggagctggacaac
aactgccagggcatcctcggctacgtggtgcgctgggtcgagcagggcgtcggttgctcc
aaggtgccggacatccacaacgtcggcttgatggaagaccgcgccaccctgcgcatctcc
agccagcacatcgccaactggctgcaccacggcgtggtcagccgcgagcaggtgcaggaa
accctggagcgcatggccaaggtggtcgaccagcagaatgccggcgatccgctctatcgc
gccatgtccagcgactacactcagtcgatcgccttccaggcggcgtccgatctggtgttc
aagggccgcgagcagccgtccggttataccgagccgctgctgcaccagtggcgccagcgc
ttcaaggccgcccagagctga

DBGET integrated database retrieval system