KEGG   Pseudomonas stutzeri DSM 4166: PSTAA_1410Help
Entry
PSTAA_1410        CDS       T01976                                 

Definition
(GenBank) oxaloacetate decarboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
psr  Pseudomonas stutzeri DSM 4166
Pathway
psr00620  Pyruvate metabolism
psr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PSTAA_1410
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:psr02000]
    PSTAA_1410
Enzymes [BR:psr01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     PSTAA_1410
Transporters [BR:psr02000]
 Other transporters
  Primary active transporters [TC:3]
   PSTAA_1410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 GCV_H ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: AEA83316
Position
1480486..1482276
Genome map
AA seq 596 aa AA seqDB search
MTVAKKPLGITDVVLRDAHQSILATRVRLEDMLPIAAKLDQVGFWSVESWGGATFDACIR
YLGEDPWERIRELKKAMPNTRQQMLLRGQNLLGYRHYADDVVEKFVERAAVNGVDVFRVF
DAMNDPRNLETALRAVKQHGKHAQGTISYTTSPVHTLEMWVDLAKQIEDMGADSVAIKDM
AGILTPYTAFELVSRLKASLAIPIHMQCHATAGLSSVAILKAVEAGIDNVDTAISSLSMT
YGHSPTESVVAMFQGTERDTGLDLELLEEIAAYFREVRKKYAKFEGNLKGVDSRILVAQV
PGGMLTNMESQLKEQGAQDKFDQVLAEIPRVREDLGFIPLVTPTSQIVGTQAVINVLTGE
RYKSITKETAGVLKGEYGAAPAPFNAELQARVLDGAEVITCRPADLLQPEMQRLTAELEG
LAREKNIKLAEDVIDDVLTYALFPQIGLKFLENRGNPSAFEPAPTGSELPAREPGKPEVY
TVEVNGKSFVVQVNEGGDIEGIKPLGADPATSAASAGSTAAAVPAGGEPQAAPLAGNIFK
VLVQPGQLVQEGDLVVILEAMKMETEIRAFKAGTVASVNVKVGDAVSVGDSLLSIA
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgacagttgctaaaaagccgctcggtatcaccgatgtggtgctgcgtgatgcccatcag
tccattctggccacccgcgtccggctagaggacatgttgccgatagccgccaagctcgat
caggtcgggttctggtcggttgagagctggggtggagcgacgttcgatgcctgtatccgc
tacctcggcgaggatccgtgggagcgcatccgtgagttgaagaaagccatgcccaacacg
cgccagcaaatgctgttgcgtgggcagaacctgctgggctatcgccactatgccgacgat
gtcgtggagaagtttgtcgagcgcgctgcggtcaacggcgtcgacgtgttccgcgtgttc
gatgcgatgaacgatccgcgtaatttggaaacggcactgcgtgcggtgaagcagcacggc
aagcacgcccagggcaccatttcctacaccaccagcccggtgcataccctggagatgtgg
gtcgatctggcgaagcagatcgaagatatgggcgccgactccgtggcgatcaaggacatg
gccggcatcctcaccccctatactgcgttcgagctggtctcgcgcctgaaggccagcctg
gccatcccgatccatatgcagtgccacgccactgccggcttgtcctcggtggctattctc
aaggcggtggaagccggtatcgacaatgtcgacactgccatctcctcgctgtcgatgact
tacggtcattcgccgaccgagtcggtggtggccatgttccagggtaccgagcgcgacacc
gggctggacctggagctgctggaagagattgccgcctactttcgagaggtgcgcaagaaa
tacgcgaagttcgagggcaacctcaaaggcgtcgattcgcgtatcctggtcgcccaggtg
ccgggcggcatgctcaccaacatggaaagccagctcaaggagcagggcgcccaggacaag
ttcgatcaggtgctggctgagattccgcgcgtgcgcgaggatctgggcttcatcccgctg
gtaaccccgacctcgcagatcgttggcacccaggcggtgatcaacgtgctcaccggtgag
cgctacaagtccatcaccaaggaaactgccggtgtactcaagggcgagtacggcgcagcg
cctgctcctttcaacgccgaattgcaggcgcgcgtgctcgacggcgcagaggtcatcact
tgccgtcccgcggatcttttgcagccggagatgcagcggttgacggccgagctcgaaggg
ttggcccgcgagaagaacatcaagctggccgaggatgtcatcgatgatgtcctgacctat
gcattgttcccgcagattggtcttaagttcctcgagaatcgcggcaatccctcggcgttc
gagccggcacccaccggcagcgagctgccggcgcgcgagccgggcaagcccgaggtgtac
accgtcgaggtcaatggcaagtcgttcgtcgtgcaggtcaacgaggggggtgacatcgaa
ggcatcaagccgctcggtgcggatcctgcgaccagcgccgccagtgccggttcgactgca
gcagccgttccggctggtggcgagccgcaggcagcaccgctggccggcaacatattcaag
gtattggtacagcctgggcagctcgttcaggagggtgacctggtggtgattctcgaggcc
atgaaaatggaaaccgagatccgtgcgttcaaggccggtaccgttgcctcggtcaacgtc
aaggttggcgacgcggtttcggtcggcgacagcttattgagcatcgcttaa

DBGET integrated database retrieval system