KEGG   Pseudomonas stutzeri DSM 4166: PSTAA_1948Help
Entry
PSTAA_1948        CDS       T01976                                 

Gene name
fadB1x
Definition
(GenBank) enoyl-CoA hydratase/isomerase FadB1x
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
psr  Pseudomonas stutzeri DSM 4166
Pathway
psr00071  Fatty acid degradation
psr00280  Valine, leucine and isoleucine degradation
psr00281  Geraniol degradation
psr00310  Lysine degradation
psr00360  Phenylalanine metabolism
psr00362  Benzoate degradation
psr00380  Tryptophan metabolism
psr00410  beta-Alanine metabolism
psr00627  Aminobenzoate degradation
psr00640  Propanoate metabolism
psr00650  Butanoate metabolism
psr00903  Limonene and pinene degradation
psr00930  Caprolactam degradation
psr01100  Metabolic pathways
psr01110  Biosynthesis of secondary metabolites
psr01120  Microbial metabolism in diverse environments
psr01130  Biosynthesis of antibiotics
psr01212  Fatty acid metabolism
Module
psr_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:psr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PSTAA_1948 (fadB1x)
   00650 Butanoate metabolism
    PSTAA_1948 (fadB1x)
  Lipid metabolism
   00071 Fatty acid degradation
    PSTAA_1948 (fadB1x)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PSTAA_1948 (fadB1x)
   00310 Lysine degradation
    PSTAA_1948 (fadB1x)
   00360 Phenylalanine metabolism
    PSTAA_1948 (fadB1x)
   00380 Tryptophan metabolism
    PSTAA_1948 (fadB1x)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PSTAA_1948 (fadB1x)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PSTAA_1948 (fadB1x)
   00281 Geraniol degradation
    PSTAA_1948 (fadB1x)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PSTAA_1948 (fadB1x)
   00627 Aminobenzoate degradation
    PSTAA_1948 (fadB1x)
   00930 Caprolactam degradation
    PSTAA_1948 (fadB1x)
Enzymes [BR:psr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PSTAA_1948 (fadB1x)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AEA83843
UniProt: F2MXJ7
Position
complement(2062127..2062900)
Genome map
AA seq 257 aa AA seqDB search
MTFETLLVDIQERVALITLNRPQALNALNAQLISELNQALGQLEADPRIGCIVLTGSAKA
FAAGADIKEMAELSYPQVYLDDLFAEADRIATRRKPLIAAVAGYALGGGCELALLCDMIF
AADNARFGQPEVNLGVLPGIGGTQRLTRAVGKAKAMDMCLTGRQMDAAEAERAGLVARVF
PAESLLEESLKAARVIAEKSLPATMMIKESVNRAFETTLAEGIRFERRVFHAVFATADQK
EGMAAFSEKRKPEFTNR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgacattcgaaaccctgctcgtcgacatccaggagcgcgtcgcgctgatcaccctcaac
cggccgcaggcgctcaacgcgctcaatgcgcagctgatcagcgagctgaaccaggccctg
ggccagctcgaggccgatccgcggatcggctgcatcgtgctcaccggctcggccaaggcg
ttcgccgccggcgccgatatcaaggaaatggccgagctgtcctacccgcaggtctatctc
gatgacctctttgccgaagccgaccgcatcgccacgcgccgcaagccgctgattgccgcc
gtcgccggttacgccctgggcggcggctgcgaactcgccttgctctgcgacatgatcttc
gccgccgacaacgcgcgtttcggccagccggaagtcaacctcggcgtgctgccgggcatt
ggcggcacccagcgcctgacccgtgcagtgggcaaggccaaggcgatggacatgtgcctg
accggtcgccagatggacgccgccgaagccgagcgcgccggcctcgtcgcgcgcgtattc
ccggccgaaagcctgctggaggaatccctcaaggctgcccgggtgatcgccgagaaatcc
ctgccggccaccatgatgatcaaggaaagcgtcaaccgcgccttcgaaaccacgctggcc
gaaggcatccgcttcgagcgtcgcgtgttccatgcggtattcgcgaccgccgaccagaag
gaaggcatggccgcgttcagcgagaagcgcaagcctgagttcaccaatcgctaa

DBGET integrated database retrieval system