KEGG   Pseudomonas stutzeri DSM 4166: PSTAA_2143Help
Entry
PSTAA_2143        CDS       T01976                                 

Gene name
galU
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
psr  Pseudomonas stutzeri DSM 4166
Pathway
psr00040  Pentose and glucuronate interconversions
psr00052  Galactose metabolism
psr00500  Starch and sucrose metabolism
psr00520  Amino sugar and nucleotide sugar metabolism
psr01100  Metabolic pathways
psr01130  Biosynthesis of antibiotics
Module
psr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:psr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PSTAA_2143 (galU)
   00052 Galactose metabolism
    PSTAA_2143 (galU)
   00500 Starch and sucrose metabolism
    PSTAA_2143 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    PSTAA_2143 (galU)
Enzymes [BR:psr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PSTAA_2143 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AEA84031
UniProt: F2N237
Position
2282973..2283812
Genome map
AA seq 279 aa AA seqDB search
MIKKCLFPAAGYGTRFLPATKAMPKEMLPVVNKPLIQYGVEEALAAGLTQIAMVTGRGKR
SLEDHFDISYELEHQIRNTDKEKYLVGIRRLIDECSFSYTRQVEMKGLGHAILSGRPLIG
DEPFAVVLADDLCINLDGDPVLAQMVKLYNQFRCSIVAIQEVPPEETSKYGVIAGEMIRD
DIFRVSHMVEKPKPEDAPSNLAIIGRYILTPDIFELIEQTEPGKGGEIQITDALMKQAKD
GCVLAYKFKGQRFDCGSAEGYIEATNFCYENFYLTGKAF
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagaaatgcctttttcccgctgccggatatggcacccgttttctccccgcaacc
aaggccatgcccaaggaaatgctgccggtggtgaacaagccgctgatccagtacggggta
gaggaggcgctggcggcagggctcacgcagatcgccatggtcaccgggcgtggcaagcgc
tcgctcgaagaccacttcgatatcagctatgagctcgagcatcagattcgcaacaccgac
aaggaaaagtacctcgtcggtattcgtcgcctgatcgacgagtgcagcttttcctacacc
cgtcaggtggaaatgaaggggctgggccacgcgattctcagcggccgtccgctgatcggt
gacgagccgttcgccgtggtgctggcagacgacctgtgcatcaacctcgatggcgacccg
gtgctggcgcagatggtcaagctgtacaaccagttccgctgctcgatagtggcgatccag
gaagtaccgccggaagaaaccagcaagtacggcgtgattgccggcgagatgattcgcgac
gacatcttccgcgtcagccacatggtcgaaaagcccaagccggaagacgccccgtcgaac
ctggcgatcatcggccgttacatcctcaccccggacatcttcgagctgatcgagcagacc
gagccgggcaagggcggtgaaatccagatcaccgacgcgctgatgaagcaggcaaaggac
ggttgcgtgctggcctacaagttcaaaggacagcgtttcgactgcggtagcgccgagggt
tacatcgaggcgaccaacttctgctacgagaacttctacctcaccggtaaggcgttctga

DBGET integrated database retrieval system