KEGG   Pseudomonas stutzeri DSM 4166: PSTAA_3377Help
Entry
PSTAA_3377        CDS       T01976                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
psr  Pseudomonas stutzeri DSM 4166
Pathway
psr00071  Fatty acid degradation
psr00072  Synthesis and degradation of ketone bodies
psr00280  Valine, leucine and isoleucine degradation
psr00310  Lysine degradation
psr00362  Benzoate degradation
psr00380  Tryptophan metabolism
psr00620  Pyruvate metabolism
psr00630  Glyoxylate and dicarboxylate metabolism
psr00640  Propanoate metabolism
psr00650  Butanoate metabolism
psr00900  Terpenoid backbone biosynthesis
psr01100  Metabolic pathways
psr01110  Biosynthesis of secondary metabolites
psr01120  Microbial metabolism in diverse environments
psr01130  Biosynthesis of antibiotics
psr01200  Carbon metabolism
psr01212  Fatty acid metabolism
psr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:psr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PSTAA_3377
   00630 Glyoxylate and dicarboxylate metabolism
    PSTAA_3377
   00640 Propanoate metabolism
    PSTAA_3377
   00650 Butanoate metabolism
    PSTAA_3377
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PSTAA_3377
   00072 Synthesis and degradation of ketone bodies
    PSTAA_3377
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PSTAA_3377
   00310 Lysine degradation
    PSTAA_3377
   00380 Tryptophan metabolism
    PSTAA_3377
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PSTAA_3377
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PSTAA_3377
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PSTAA_3377
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:psr04147]
    PSTAA_3377
Enzymes [BR:psr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PSTAA_3377
Exosome [BR:psr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PSTAA_3377
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AEA85244
UniProt: F2N2W1
Position
3576759..3577940
Genome map
AA seq 393 aa AA seqDB search
MQDVVIVAATRTAIGSFQGSLANVPAVELGATVIRALLEKTGIDPAQVDEVILGHVLTAG
AGQNTARQASIKAGLPHAVPSMTLNKVCGSGLKAVHLAVQAIRCGDAEVVIAGGMENMSL
APYVLPGARTGLRMGHAQIVDTMITDGLWDAFNDYHMGITAENLADKYGIDRAQQDAFAA
QSQQRAAAAIESGRFDAEITPVMIPQRKGDPVAFARDEQPRAGTTAESLGGLRAAFKKDG
CVTAGNASTLNDGAAAVVLMSASKAEALGLPVLAKIAGYANAGVDPAIMGIGPVTATRRC
LEKAGWTLAELDLIEANEAFAVQALSVGKELGWDADKVNVNGGAIALGHPIGASGCRILV
TLLHEMQRRDVRKGLATLCIGGGQGVALAVERP
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacgtcgtcatcgtagctgcaacccgcaccgccatcggcagtttccagggctcg
ctggccaatgtgccggcagtcgaactgggcgccaccgtgatccgcgccctgctggaaaag
accggtatcgacccggcccaggtcgatgaagtcatcctcggccatgtgctcaccgccggc
gccgggcagaacaccgcgcgccaggcctcgatcaaggccggcctgccccacgcggtaccg
tccatgacgctgaacaaggtctgcggctcgggcctcaaggccgtgcatctggccgtgcag
gcgatccgctgcggcgatgccgaagtggtcatcgccggcggcatggagaacatgagcctg
gcgccctacgttctgcccggcgcacgcaccggcctgcgcatgggccacgcgcagatcgtc
gataccatgatcaccgatggcctgtgggacgccttcaacgactaccacatgggcatcacc
gcggagaacctggccgacaagtacggcatcgaccgcgcccagcaggacgccttcgccgca
cagtcgcagcagcgtgccgcggcggccatcgaaagcggccgcttcgatgccgagatcacc
ccggtcatgattccccagcgcaagggcgacccggtcgccttcgcccgtgacgagcagccg
cgcgccggcaccacggccgaatccctcggcggcctgcgtgcagccttcaagaaggacggc
tgcgtcaccgccggcaacgcctcgaccctcaacgacggcgccgccgcagtggtgctgatg
agcgccagcaaggccgaggccctgggcctgccggtgctggccaagatcgccggctacgcc
aacgccggcgtcgacccggcgatcatgggcatcggcccggtcaccgccacccgccgctgc
ctggaaaaggccggctggacgctggccgagctggacctgatcgaagccaacgaagccttc
gccgtgcaggcgctgtcggtgggtaaggaattgggctgggatgccgataaggtcaacgtg
aacggcggcgccatcgccctcggccacccgatcggcgcctcgggctgccgtatcctggtg
accctgttgcacgagatgcagcgccgcgatgttcgcaagggcctggcgacactgtgcatt
ggtggtggccagggagtagccttggcagtcgaacgcccctaa

DBGET integrated database retrieval system