KEGG   Pseudomonas stutzeri DSM 4166: PSTAA_4020Help
Entry
PSTAA_4020        CDS       T01976                                 

Definition
(GenBank) short chain dehydrogenase/reductase family oxidoreductase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
psr  Pseudomonas stutzeri DSM 4166
Pathway
psr00030  Pentose phosphate pathway
psr01100  Metabolic pathways
psr01120  Microbial metabolism in diverse environments
psr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:psr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PSTAA_4020
Enzymes [BR:psr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     PSTAA_4020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase GDP_Man_Dehyd Glyco_tran_WecB
Motif
Other DBs
NCBI-ProteinID: AEA85875
Position
complement(4316532..4317299)
Genome map
AA seq 255 aa AA seqDB search
MRLQNQVALVTGSTQGIGRGIAVRLAEEGADIVINGRENDEQARESLEQVRALGRRVCFI
AADVGDVEQCHRLVRESIAQMGQLDILVNNAGVQRHAAFLDVQADDYDQVLNVNLRGPFF
LAQAFARHLREQGRGGRIINNSSVHEELPHPNFTAYCASKGGLKMLMRNIAIELAPLGIT
VNNVAPGAVETPINRELMNQPDKLANLLQNIPAGRLGRPHDVAGVVAFLASPDAEYITGT
TLVVDGGLLWNYSEQ
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttgcagaatcaggtggctctggtcaccggcagcacccagggcatcggccgcggc
attgccgtgcgcctggctgaagagggcgccgacattgtcatcaacggccgcgagaacgac
gaacaggcccgcgagagcctcgagcaggtccgcgccctgggccggcgggtgtgcttcatc
gccgccgatgtcggtgacgtcgagcagtgccaccggctggtgcgcgagagcatcgcgcag
atggggcagctggacatcctggtcaacaatgccggtgtgcagcggcacgcggcgttcctc
gacgtgcaggcggacgattatgatcaggtgctgaacgtcaacctgcgtgggccgttcttc
ctcgcccaggcgtttgcccgccatttgcgcgagcagggccgcggcggacgcatcatcaac
aacagctcggtgcacgaagagctgccgcatcccaacttcaccgcctactgcgcgagcaag
ggcggactgaagatgctgatgcgcaacatcgccatcgagctggcgccgctgggcatcacg
gtgaacaacgtggcgcccggcgcggtggaaacgccgatcaaccgcgagctgatgaatcag
ccggacaagcttgccaacctgctgcagaacatccctgccggccgtctcggccgcccgcac
gacgtcgccggcgtcgttgcctttctggcctcacccgacgccgagtacatcaccgggact
acactggtggtcgatggcggcctgctatggaactacagcgagcaatga

DBGET integrated database retrieval system