KEGG   Pseudomonas stutzeri DSM 4166: PSTAA_4086Help
Entry
PSTAA_4086        CDS       T01976                                 

Gene name
metF
Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
psr  Pseudomonas stutzeri DSM 4166
Pathway
psr00670  One carbon pool by folate
psr01100  Metabolic pathways
psr01120  Microbial metabolism in diverse environments
psr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:psr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    PSTAA_4086 (metF)
Enzymes [BR:psr01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     PSTAA_4086 (metF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: AEA85941
Position
4384636..4385487
Genome map
AA seq 283 aa AA seqDB search
MTSSNRPSISFEFFPTKTEAGHEKLLNVARQLAGYQPDFFSCTYGAGGSTRDRTLNTVLQ
LDGEVKIPTAPHLSCVGDTKAELRELLNLYKSAGIQRIVALRGDLPSGMGMASGELRYAN
ELVEFIRAETGDHFHIEIAAYPEMHPQARNFEDDLANFVRKAKAGADSAITQYFFNADCY
FYFVERVRKLGVQTPVVPGIMPITNYSKLARFSDACGAEIPRWVRKQLEAYGDDMQSIQA
FGEQVITEMCQKLLAGGAPGLHFYTLNQAEPSLAIWNNLGLSR
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgacctcttcaaatcgcccttccatcagcttcgagttcttccccaccaagaccgaagcc
gggcatgaaaaactgctgaacgtggcgcgccagctggcgggctaccagcccgatttcttc
tcctgcacctacggtgccggtggctcgacgcgcgaccgcacgctcaacaccgtgctgcaa
ctcgacggtgaggtgaagatccccaccgcaccgcacctgtcctgcgttggcgacaccaag
gccgagctgcgcgagctgctgaacctctacaagagtgccggcatccagcgcatcgtcgcc
ctgcgcggcgacctgccgtcgggtatgggcatggccagcggcgagctgcgctacgccaac
gaactggtggagttcatccgcgccgagaccggtgaccactttcatatcgagatcgccgcc
tacccggaaatgcatccccaggcgcgcaacttcgaggacgacctggcgaacttcgtgcgc
aaggccaaggccggcgccgacagtgcgattacccagtacttcttcaatgccgactgctac
ttctacttcgtcgagcgcgtgcgcaagctcggggttcagacgccggtggtgccgggcatc
atgccgatcaccaattacagcaagctggcccgcttctccgatgcctgtggcgcggagatc
ccacgctgggtgcgcaagcagctcgaagcctatggcgacgacatgcagagcatccaggcc
ttcggcgagcaggtgatcaccgaaatgtgccagaagctgctggccggcggtgcgccgggc
ctgcacttctacacgctgaaccaggccgaaccgagcctggcgatctggaacaacctcggg
ctgtcgcgctga

DBGET integrated database retrieval system