KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102443559Help
Entry
102443559         CDS       T02980                                 

Gene name
NLN
Definition
(RefSeq) neurolysin, mitochondrial isoform X1
  KO
K01393  neurolysin [EC:3.4.24.16]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Brite
KEGG Orthology (KO) [BR:pss00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pss01002]
    102443559 (NLN)
Enzymes [BR:pss01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.16  neurolysin
     102443559 (NLN)
Peptidases and inhibitors [BR:pss01002]
 Metallo peptidases
  Family M3
   102443559 (NLN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M3 TSC22
Motif
Other DBs
NCBI-GeneID: 102443559
NCBI-ProteinID: XP_006117078
Ensembl: ENSPSIG00000011342
Position
Unknown
AA seq 736 aa AA seqDB search
MCREHGTGFCMFTEVQKSGTFWVIGGYLDPKTVPHNEEKLRAGGPRFLLRMTLGTEITAP
PKASSHAASDQNFLKWDLSPEQIRTRTEDLITKTKQVYDNVGMLDFEKVTYENTVQALAN
IEVEYSVERSMLDFPQHVSSKKDVRSASTEADKRLSYFDVEMSMREDVFQRIVYLQQTRD
LGYLKPEAKRYLEKSIKMGKRNGLHLTKEVQNEIKTMKKQLSELCIDFNKNLNEENTFLM
FSKDELQALPDEFINSLEKTGKNKYKVTLKYPHYFSVIKKCCVPETRRKMETAFNMRCKE
VHQIFNENAKILQQLLPLRSKVAELLGYSTHANFVLEVNTAKSTDNVTTFLDDLSKKLKP
LGDEEREYILELKKKECEERGFNYDGRINAWDLHYYMNKTEELKYSIDQEKLKEYFPVEA
VTQGLLSIYQELLGLVFEQVENAHVWHESVTLYTVKDDSTREVLGQFYLDLYPREGKYGH
AACFGLQPGCLRSDGSRMMSVAALVTNFTKPASDRPSLLRHDEVKTYFHEFGHVMHQICA
QTDFARFSGTNVETDFVEVPSQMFENWVWEKEPLQQMSKHYKDGSHIADALLEKLVASRK
ANTGLLTLRQIVLSKVDQSIHTKSYADPADEYAKCCMEILGISATPGTNMPATFGHLAGG
YDGQYYGYLWSEVFSTDIFYNCFKQEGIMNPKAGMKYRNLILKPGGSLNGMELLQNFLQR
KPNQNAFLLSKGLNTQ
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgtgcagagaacatgggactggtttctgtatgtttacagaagtgcagaaaagtggaacg
ttttgggtgattggaggatatctggatccaaagactgtcccacataatgaggaaaagttg
agagctggtggcccacggtttttattgagaatgacgttgggaacagaaattactgcccct
cccaaagcctcttcacatgcagcatcagaccaaaactttttgaaatgggacctatcacca
gagcaaatcagaacaagaacagaagatctgatcacaaaaacaaagcaagtgtatgacaat
gtaggaatgcttgattttgaaaaggtaacatatgagaacactgtgcaggctctagccaat
atagaagtggagtattcagtggaaagaagcatgttggatttcccacagcatgtctcatcc
aaaaaagatgtgcgctcagcaagcacagaagctgacaaaaggctttcttattttgatgtg
gagatgagcatgagagaagatgtgtttcaaaggattgtttatttacagcaaacacgtgat
ctaggatatttaaagcctgaagctaagcgatacttagagaagtcaattaaaatgggaaaa
aggaatggactccatcttaccaaagaagtacagaatgaaataaagaccatgaagaaacaa
ttgagtgagctgtgtatagacttcaataaaaacctcaatgaggaaaacacatttcttatg
ttttctaaggatgaacttcaagcccttcctgatgaatttattaatagcttagaaaagact
ggaaagaacaagtataaagttacattaaaatatccccactatttttctgtcataaaaaag
tgctgtgttccagaaacaagaagaaaaatggaaactgcctttaacatgagatgcaaggag
gtacatcagatatttaatgaaaatgctaaaattcttcagcagttgcttcccttaaggtca
aaagtagcagagcttcttgggtacagtacacatgccaactttgtactggaagtgaacact
gcaaagagcacagataatgtaacaacctttttagatgatttaagtaagaaactaaaacca
ctgggtgatgaagaaagagagtatattttggaattgaagaaaaaagagtgtgaagaaaga
ggctttaactatgatggaagaatcaatgcatgggatttacattactatatgaacaagaca
gaagagcttaaatattccatagatcaagagaagctgaaagaatattttccagttgaagct
gttacacagggcttattgagcatttaccaggagttgctgggacttgtatttgagcaggta
gaaaatgctcatgtttggcatgagagtgttactctttatacagtaaaagatgattcaaca
agagaagttttagggcagttttatttagacctctatcccagagaagggaagtatggacat
gcggcatgctttggtctccagcctggctgtctacgctctgatggcagcagaatgatgtct
gttgctgctctggtgaccaacttcaccaaaccagcatcagatcgcccatctttgctgcga
catgatgaagtgaagacttacttccatgagttcggtcatgtaatgcaccagatatgtgca
caaactgattttgccagatttagtggaactaatgtggaaacagactttgtagaagttcct
tcacaaatgtttgagaactgggtttgggaaaaagagcctctacagcaaatgtcaaaacat
tataaagatgggagccatattgcagatgctcttcttgagaaacttgttgcctctagaaag
gccaatacaggtcttttgactcttcgtcagattgttttgagcaaggttgaccagtccatt
cataccaaatcatatgctgaccctgcagatgaatatgccaaatgctgcatggagattctg
ggaatttctgcaaccccaggaacaaatatgccagctacttttggacatttggcaggtgga
tatgatggtcaatactatggatatttgtggagtgaagttttttccacggatattttttat
aactgttttaaacaagaaggaataatgaatccaaaggctggaatgaaatatagaaacctt
attctgaaacctggaggatctttgaatggaatggaattacttcaaaatttcttacaacgt
aaaccaaatcagaacgctttcttgttgagtaagggattaaatactcagtga

DBGET integrated database retrieval system