KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102444010Help
Entry
102444010         CDS       T02980                                 

Gene name
MAP4K4
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase kinase 4 isoform X1
  KO
K04407  mitogen-activated protein kinase kinase kinase kinase 4 [EC:2.7.11.1]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:pss00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102444010 (MAP4K4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pss01001]
    102444010 (MAP4K4)
Enzymes [BR:pss01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102444010 (MAP4K4)
Protein kinases [BR:pss01001]
 Serine/threonine kinases: STE group
  STE20 family
   102444010 (MAP4K4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CNH Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 102444010
NCBI-ProteinID: XP_025045489
Ensembl: ENSPSIG00000017311
Position
Unknown
AA seq 1338 aa AA seqDB search
MRKELNNILSYKIHAFCFVPKDEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDD
QLWLVMEFCGAGSITDLVKNTKGNTLKEDWIAYISREILRGLAHLHAHHVIHRDIKGQNV
LLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSC
GITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPS
TEQLLKHPFIRDQPNERQVRIQLKDHIDRTRKKRGEKDETEYEYSGSEEEEEEVPEQEGE
PSSIVNVPGESTLRRDFLRLQQENKERSEALRRQQLLQEQQLREQEEYKRQLLAERQKRI
EQQKEQRRRLEEQQRREREARRQQEREQRRREQEEKRRLEEMERRRKEEEERRRAEEEKR
RVEREQEYIRRQLEEEQRHLEILQQQLLQEQAMLLEYRWREMEEHRQAERLQRQLQQEQA
YLLSLQHDHRRQQQQQQQERNKQSYHIPEPKSQYEPTERAREVEDRFRKTNQGSPEAQSK
QTGKVLEPPVPSRSESFSNGNSEPVQPALQRPMEPQVQWSHLASLKNNVSPVSRSHSFSD
PSPKFAHHHLRSQDPYLPSRSEVLNQSSDSKSEVPDPTQKAWARADSDEVPPRVPVRTTS
RSPVLSRRDSPLQGSGQQNNQAGQRNSTSNIEPRLLWERVEKLVPRPGSGSSSGSSNSSS
QPGSHPGSQSGSGERFRMRSSSKSEGSPSQRHENAVKKPEEKKEVLRPSKPAGEVDLTAL
AKELRAVEDVRPPHKVTDYSSSSEESGTTDEEDDDMEQEGADESTSGPEDARAVSTLNLS
NGETESVKTMIVHDDVESEPAMTPSKEGTLIVRQSTVDTKRASHHESNGFAGRIHLLPDL
LQQSHSSSTSSTSSSPSSSQPTPIMSPQTPQDKLTTNETQSASNTLQKHKSSSSFTPFID
PRLLQISPSSGTTVTSVVGFSSEAMRSEAIRQDPTRKGSVVNVNPTNTRPQSDTPEIRKY
KKRFNSEILCAALWGVNLLVGTESGLMLLDRSGQGKVYPLINRRRFQQMDVLEGLNVLVT
ISGKKNKLRVYYLSWLRNKILHNDPEVEKKQGWTTVGDLEGCVHYKVVKYERIKFLVIAL
KSSVEVYAWAPKPYHKFMAFKSFGELVHKPLLVDLTVEEGQRLKVIYGSCAGFHAVDVDS
GSVYDIYLPTHIQSSIQPHAIIILPNTDGMELLVCYEDEGVYVNTYGRITKDVVLQWGEM
PTSVAYIRSNQIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVRSG
GSSQVYFMTLGRTSLLSW
NT seq 4017 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaggagctaaataatatattgtcatataaaatacatgctttttgttttgttcca
aaggatgaagaagaagaaatcaaactggagataaatatgctaaagaaatattctcatcat
agaaacattgcaacttattacggtgctttcattaagaaaagtcccccaggacatgatgac
caattgtggcttgttatggaattttgtggagcaggctctatcacagaccttgtgaagaac
acaaaaggaaacactctaaaagaagactggatcgcatatatctccagagagattctccgg
ggattggcacatctgcatgcccaccatgtgattcatcgggatatcaaagggcagaatgta
ttgttaacagaaaatgcagaggtgaagcttgtcgattttggtgttagtgcccagctggac
agaacggttggcaggagaaacacatttattggaactccatattggatggctccagaagtt
attgcctgtgatgaaaatccagatgctacatatgattacagaagtgacctctggtcatgt
ggcattacagccattgaaatggcagaaggagctccccccctctgtgacatgcatccaatg
agggcactgtttcttatacccagaaaccctccaccacggctaaaatccaagaaatggtca
aaaaagttctttagttttatagaaggctgtttagtgaagaactatatgcagagaccctcc
actgaacagcttttaaaacacccttttatacgcgatcagccaaatgaaaggcaagtccga
atccagcttaaggatcatatagacaggaccagaaagaagagaggagagaaggatgagaca
gaatatgaatatagtggaagtgaggaagaggaggaggaagtgcctgaacaagaaggagag
ccaagttcaattgtcaatgtgcctggagaatctaccctccgacgtgatttcctgagattg
cagcaggaaaacaaggaacgttcagaggcccttcggagacaacagctgctacaggaacag
cagctccgagagcaggaggaatacaagaggcagctgttggcagagagacagaaacgcata
gagcaacagaaagagcaaaggaggcggctagaagagcaacaaagaagagaacgggaagct
cggaggcaacaagagcgtgagcagaggcgaagagaacaggaggagaaaaggcggctagaa
gaaatggagaggaggcgtaaggaagaggaagagaggaggagagcagaggaagaaaagagg
agagtggagagagaacaggagtatatcaggcgacagctagaagaggagcagcggcacttg
gaaattcttcagcagcagctgctccaggagcaggccatgttactggaatacagatggcga
gagatggaggagcatcgacaagcagagagactccagcgccagttgcaacaggagcaagcg
tatctcctgtcactgcagcatgatcataggcggcagcagcagcagcagcagcaggaaagg
aataaacaaagctatcatatccctgagcctaaatcccagtatgaacctactgaaagagca
cgtgaggtggaggatagatttagaaaaactaaccagggctcccctgaagcacagtctaaa
cagacgggcaaagtgttggagccaccagtgccttcaagatcagagtccttttccaatgga
aactcagagcctgtccagcctgcactgcaaaggccaatggaaccccaggtacagtggtcc
catctggcatctctcaagaacaatgtttcccctgtctcgcgatcccattccttcagtgac
ccttctcctaaatttgcacatcaccatcttcgttctcaggacccatatctaccttcacgc
agtgaagtgctaaatcagagttctgactctaagtcggaggtacctgaccccactcaaaag
gcttgggctagagcagacagtgacgaggtgcctccaagggtacctgtgagaacaacatcc
aggtctcccgtcctatctcgtcgagattctccactgcagggcagtgggcagcaaaataat
caagcagggcaaagaaactccacgagcaacatagagcctcgtctgctatgggaaagggtt
gagaaactcgtgccgagaccaggcagcggcagttcctctggctcaagtaactccagctca
cagccgggttcccatcctggatctcagagtggctctggtgaacgattccgaatgagatca
tcatccaaatctgaaggttcaccatctcaacgtcatgaaaatgcagtcaaaaaacctgaa
gaaaagaaggaagtcctcagacccagcaagcctgctggagaagtggatttaactgccttg
gctaaagaattgcgagctgtagaggatgtgcgacctccgcacaaggtgacagattattca
tcgtccagtgaagagtccgggacgacagatgaggaggatgacgatatggaacaagaagga
gccgatgaatctacgtctgggccagaagacgccagagctgtgtcgactctgaacttgagc
aatggtgaaacagagtcggtgaaaaccatgattgtccatgatgatgtggagagtgaacct
gctatgaccccttccaaggagggaactttaatcgtccgacagagtacagttgacacaaag
cgtgccagccatcatgagagcaatggctttgccggtcgcattcacctcttgccagatctc
ttacagcaaagccattcctcctccacttcttccacctcctcctccccatcctccagccag
ccgacacccatcatgtccccacagacaccccaggacaagctaactactaatgagactcag
tccgctagtaacacactccagaaacacaaatcttcctcctcctttacaccttttatagac
cccagattactacagatttctccatctagtgggacaactgtgacttctgtggtgggattt
tctagtgaagccatgaggtcagaggcaataaggcaagatcctaccaggaagggatcagtt
gtcaatgtgaatcctaccaatacacgaccacaaagcgacaccccagaaattcgcaaatac
aagaagagattcaattctgagattttgtgtgccgccttatggggagtgaatttgctagtg
ggaaccgagagtggtctgatgctgctagacagaagtggtcaagggaaggtttatcctcta
ataaatcgaagacggttccagcagatggatgtactcgaaggcctgaatgtcttggtgaca
atatctggtaagaagaacaagttgcgagtgtactacttgtcctggctaagaaataaaatc
ctacataatgatcctgaagtagaaaagaagcagggttggacaacggtgggcgacttggaa
ggctgtgtgcactataaagttgtaaaatatgaaagaatcaaattcttggtaattgctttg
aagagttctgtggaagtctatgcatgggcaccaaagccataccacaaatttatggcgttt
aagtcatttggagaattggtacataagccattgctggtggatctaactgtagaggaaggt
cagaggctgaaggtgatctatggttcctgtgctggtttccatgctgttgatgtggactcg
ggatcagtctatgatatttacctgccaacacatatccaaagcagcatccaaccacatgca
atcattattctcccaaacacggatgggatggagctgctggtttgctatgaggatgaagga
gtttatgtaaatacctatgggaggatcaccaaagatgtggttctgcagtggggagagatg
cccacatcagttgcatacattcgatccaatcagattatgggctggggagaaaaggctatc
gagataagatcagtggaaactgggcatttggacggtgtgttcatgcacaaaagggcacag
agactcaagttcttatgtgagcgtaatgacaaggttttctttgcctctgtacggtctggt
ggaagcagtcaagtttatttcatgaccctaggcaggacttctcttctgagttggtag

DBGET integrated database retrieval system