KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102444422
Entry
102444422         CDS       T02980                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss00230  Purine metabolism
pss00240  Pyrimidine metabolism
pss01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pss00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102444422 (DCK)
   00240 Pyrimidine metabolism
    102444422 (DCK)
Enzymes [BR:pss01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     102444422 (DCK)
SSDB
Motif
Pfam: dNK Thymidylate_kin AAA_17 AAA_18
Other DBs
NCBI-GeneID: 102444422
NCBI-ProteinID: XP_025034225
Position
Unknown
AA seq 180 aa
MMYEKPDRWAYTFQTYACLSRIRAQLNCLNGKIKEMENPVVFFERSVYSDRYIFASNLYE
SDCMNETEWTIYQDWHEWMNKQFGQSLQLDGIIYLRATPEKCLNRIYLRGRDEEQEIPVE
YLEKLHYKHESWLQHRTLRTDFEYLEELPILTLDVNEDFKGNKDKYDDMIEKVKEFLSTL
NT seq 543 nt   +upstreamnt  +downstreamnt
atgatgtatgagaaacccgaccggtgggcatacactttccagacctacgcctgcttgagc
agaatccgggctcagctcaactgccttaatgggaaaattaaagagatggagaaccctgtg
gtcttcttcgagcgatctgtgtatagtgacaggtatatttttgcatcgaatttatatgaa
tctgattgcatgaatgagactgaatggactatttaccaagattggcatgaatggatgaat
aagcagtttggtcaaagccttcaactggatggaattatttatctcagagccactcctgag
aaatgcttaaataggatttacttgcgtggaagagatgaagaacaagaaattcctgttgaa
tatctggagaagcttcactacaaacatgaaagctggcttcaacatagaacattgcggacg
gactttgaatacttggaagaactacctatcttaacactggatgttaatgaagatttcaaa
ggcaacaaagacaagtatgatgatatgattgaaaaggtcaaggaatttttgagcacttta
taa

DBGET integrated database retrieval system