KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102444587Help
Entry
102444587         CDS       T02980                                 

Gene name
ACAT2
Definition
(RefSeq) acetyl-CoA acetyltransferase, cytosolic
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss00071  Fatty acid degradation
pss00072  Synthesis and degradation of ketone bodies
pss00280  Valine, leucine and isoleucine degradation
pss00310  Lysine degradation
pss00380  Tryptophan metabolism
pss00620  Pyruvate metabolism
pss00630  Glyoxylate and dicarboxylate metabolism
pss00640  Propanoate metabolism
pss00650  Butanoate metabolism
pss00900  Terpenoid backbone biosynthesis
pss01100  Metabolic pathways
pss01200  Carbon metabolism
pss01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pss00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    102444587 (ACAT2)
   00630 Glyoxylate and dicarboxylate metabolism
    102444587 (ACAT2)
   00640 Propanoate metabolism
    102444587 (ACAT2)
   00650 Butanoate metabolism
    102444587 (ACAT2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102444587 (ACAT2)
   00072 Synthesis and degradation of ketone bodies
    102444587 (ACAT2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    102444587 (ACAT2)
   00310 Lysine degradation
    102444587 (ACAT2)
   00380 Tryptophan metabolism
    102444587 (ACAT2)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    102444587 (ACAT2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pss04147]
    102444587 (ACAT2)
Enzymes [BR:pss01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     102444587 (ACAT2)
Exosome [BR:pss04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102444587 (ACAT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C Dodecin
Motif
Other DBs
NCBI-GeneID: 102444587
NCBI-ProteinID: XP_006115072
Ensembl: ENSPSIG00000008840
UniProt: K7FP58
Position
Unknown
AA seq 397 aa AA seqDB search
MSAGGSEAVVLVSAARTPVGSFNGALSTIHAHELGSIVIKEVLQRANVNPEEVSEVIFGQ
VLTAGAGQNPVRQASVAAGIPYAVPAWSCQMICGSGLKAVCLGAQSILTGDSSIVVAGGM
ESMSKAPHLVHMRAGVKMGEASLQDSIINDGLTDAFYHYHMGITAENVAKQWQISRREQD
QFAVQSQNRAESAQKAGYFDKEIVPVLVPSRKGPVEVKADEHPRHGSTLETVSKLKPCFL
TDGTGTVTAANASGVNDGAAAVILMKASEAARRGLTPLAHIVSWAQVGLEPSIMGIGPVP
AIKKAVDKAGWTLEQVDLFEINEAFASLAVAITKELKLNPEKVNIEGGAVALGHPLGASG
GRILVTLLYALERTAGKRGVAALCIGGGMGIAMCIER
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcaggcggctcagaagcggtggtgcttgtttctgctgcaagaacccctgtcggt
tcctttaatggtgccttgtccacaattcatgcccatgaactgggctctattgtcattaaa
gaagtactgcagagggcaaatgtcaatccggaagaagtatctgaagttatatttggacaa
gtcttgacagcaggcgctggtcagaatcctgtacgacaagccagtgttgctgcaggaatc
ccatatgcagtaccagcttggagctgtcagatgatatgtggttcaggcctaaaagcagta
tgcttgggggctcagtccatactgacaggagattcgagcattgtggtggcaggaggcatg
gaaagcatgagcaaggctcctcatttagttcatatgcgagctggagtgaaaatgggggag
gcctctttgcaggacagtataatcaatgatggtcttacagatgctttttaccattatcac
atgggtataacagctgaaaatgtggccaagcagtggcaaattagcagacgagaacaagac
caatttgctgtacagtcacagaacagggcagagagtgcacagaaagctggctactttgat
aaagagattgttcctgttcttgtgccttctaggaaaggtcctgtagaagttaaagcagat
gagcatcctcgccatggaagcaccctagaaacagtatcaaagttaaagccttgctttctg
acagatggaactggaacagtaactgcagcaaatgcctcaggtgtgaatgatggagctgca
gctgtaattcttatgaaggcatctgaagcagctagaagaggtcttactccattggcgcat
attgtgtcctgggctcaagtgggtttagagccatccatcatgggaataggacctgtcccc
gcaataaagaaagctgttgacaaagcaggttggacactggaacaagttgacttgtttgaa
attaatgaagcatttgcatcactagctgtagcaataactaaagaactgaaattgaatcca
gagaaggttaacatcgaaggtggagctgttgctcttggtcaccctctgggtgcctctggt
ggtcgtattcttgttacgcttctgtacgcactagaacgaacagctggaaaacgtggtgtt
gctgctctttgtataggagggggaatgggaatagctatgtgcattgaaagatga

DBGET integrated database retrieval system