KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102444673Help
Entry
102444673         CDS       T02980                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: 5-beta-cholestane-3-alpha,7-alpha-diol 12-alpha-hydroxylase
  KO
K07431  sterol 12-alpha-hydroxylase [EC:1.14.18.8 1.14.14.139]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss00120  Primary bile acid biosynthesis
pss01100  Metabolic pathways
pss03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:pss00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    102444673
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    102444673
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:pss00199]
    102444673
Enzymes [BR:pss01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.139  5beta-cholestane-3alpha,7alpha-diol 12alpha-hydroxylase
     102444673
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.8  7alpha-hydroxycholest-4-en-3-one 12alpha-hydroxylase
     102444673
Cytochrome P450 [BR:pss00199]
 Cytochrome P450, animal type
  CYP8 family
   102444673
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 102444673
NCBI-ProteinID: XP_006120681
Position
Unknown
AA seq 484 aa AA seqDB search
MAFWEAVLYVLLASILCGLYLLGAFRRRRPQEPPLDKGYIPWLGYALDFRKNSAEFLKKM
QKRHGDIFTVLIGGYYFTFVMDPFSFGTIVKAPRAKLDFETFAVELVIRVFGYHPCQKDH
KTIQLASTKHLMGDGLVVMTQAMMENLQTLLFHNRGSGEEERPWQQDGLFHYSYNIVFRA
GYLALFGNEPGKGTQREEKAQKRDLAHSEELFNEFRKYDRLFPRLAYAVLPPRDKMEAER
LKRLFWKVLSVKNSYQKDNISGWISDQEQFLAEAGMPEYMRDRFMFLLLWAAQGNTGPSS
FWLLLYLMKHPEAMQAVRKEVNTVLREAGQEVKPGSPVVTITRDMLMKTPVLDSAVEETL
RLTAAPILIRAVVEDLNLRMXVHPEPHTFKYNRFLNEDGTKKDFYKNGKKLKYFNMPWGA
GTSICPGRFFAVNEIKLFVFLMVAYYDLELVNEKEEIPPIDVSRWGFGSMQPTHDVQFKY
RLRI
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggctttctgggaagcagttctctacgtactgctagcctcgattctctgtgggctctat
ctcctgggagcgtttcgaaggaggagaccgcaggagcctcccctggataagggctatatt
ccatggctggggtacgcactagatttcagaaagaacagcgcagagttcctgaaaaagatg
cagaagagacatggggacattttcactgtgctgattggaggctactacttcaccttcgtc
atggaccccttctcgttcggcaccattgtgaaggcgcccagagccaaactcgacttcgag
acgtttgcggtagaactggtcatcagggtttttgggtatcacccgtgtcaaaaagaccat
aagaccattcagctggccagcacaaaacacctcatgggcgatgggctcgtggtcatgacc
caggccatgatggagaatttgcagaccctcctgtttcacaacaggggttcaggagaagag
gagagaccctggcagcaggatggactcttccactacagctacaacattgtcttccgagct
ggctacctggctttgtttggaaacgagccggggaaagggacacagcgtgaggagaaagcc
cagaagcgtgatctcgcccactccgaagagctgtttaatgagttccggaagtacgaccgc
ctcttcccccgcttggcctacgctgtgctgccccccagggataaaatggaagcagagagg
ctgaagaggctcttttggaaggtgctttctgtgaagaacagctatcagaaggataacatc
agcgggtggataagtgaccaagaacagttcctggcagaggccgggatgcctgagtacatg
cgggatcggttcatgtttctgcttctctgggcagctcaaggtaacacaggcccaagctcc
ttctggctcctcttgtatctcatgaaacatcccgaagcaatgcaggctgtgaggaaagaa
gtgaacacagttttaagagaagctggtcaggaagtaaagccaggcagtcctgtggtgacc
atcaccagggacatgttaatgaagaccccagtcctggacagcgctgtggaggagaccctg
cgcctcacggcagcccctattctgatcagagcagtggttgaggacctgaatctcaggatg
naagtgcatcctgagccccacaccttcaaatacaaccggttcctgaacgaagacggcacc
aaaaaagatttctacaagaatgggaaaaaactgaaatattttaacatgccctggggtgca
ggcacctcgatctgccctgggcggttctttgctgtcaatgaaatcaaactgtttgtgttc
ctgatggtggcttactatgacttggagctagttaacgagaaagaggagatccctccgata
gacgtaagccgatggggatttggttccatgcagcccactcacgatgtccagtttaaatat
cggctacgtatttaa

DBGET integrated database retrieval system