KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102445331
Entry
102445331         CDS       T02980                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: aryl hydrocarbon receptor-like
  KO
K09093  aryl hydrocarbon receptor
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Brite
KEGG Orthology (KO) [BR:pss00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pss03000]
    102445331
Transcription factors [BR:pss03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    102445331
SSDB
Motif
Pfam: PAS_3 PAS PAS_11 HLH PAS_9
Other DBs
NCBI-GeneID: 102445331
NCBI-ProteinID: XP_025042675
Position
Unknown
AA seq 904 aa
CVSFCSSLGSVKPPPLEGVKSNPSKRHRDRLNSELERLAGLLPFPEEVVSTLDKLSILRL
SVSYLRAKSFFHIALKSHCGKGGAERSGDRDKGRTLGRADGILPEGELLLQALNGFVLVV
TSEGEIFYSSHTIQDYLGFHQTDVLHQSVFELIHTEDQPEFRRNLHWALSPPPAPESAPS
PEGDVGAGSSLPAYEPGQLPPENSAFLERSFVCRFRCLLDNSSGFLALNLQGRLKFLHGQ
KQRSEDGSLLPPQLALFVISTPLQPPSILEIRTKNMIFRTKHTLDFTPLACDAKGKIVLG
YTEAELRMRGTGYQFIHAADMLYCAENHVRMMKTGESGLTVFRLLTKNNSWKWRQGQAPL
XYIVATQRPLAEEEGDDHLRKRSMHLPFTFAMGEALLYQSACPFPGFPEPLPSKGKPRKP
KKHSLGKGGRPQKDSVDPNSLLGAMMRQNAAVYVSHPASTPRHAVSRPLTPHQGSSGFSG
SGEDGWSGVANALASGETGPKPVLADGRPGDPLLGSLSSSSEEACSTHEMFAALEGLGLT
AEDLELLLLDERMVRVDLDLDRVPSLNDLLTNNEILSYVHGSLASRCEGGPTGEQQACPL
SGPAPNPSPDLGACPSQMPEERYPCSSQPPTPLILHLPQQMQQCLASQSPRGSQPWEPPL
PCGRSQQADEEQPPGLQWRPPAGAAEVGPSPVGQAPLGNRPQGPQWVRPPGSRHLHEPLA
PPYQQQQPAAPLESSPYAGPGAAGPFLQQSQPCLPPRPAQAHTEPLSQLMLKPDQHLLVN
GLDDHASASRPALGNNTWQRCWPANQPPHVCGVERGRLCLSQLCPAPVPNPGGAALPFYL
DGLPSTGTGARGACQEEMTPCPGFVPPSSYPPKPPTPVPLASQYPALEHWGAAQGQQEGS
LHSC
NT seq 2712 nt   +upstreamnt  +downstreamnt
tgtgtctccttttgctcctcccttggcagcgtgaagccaccgcccctggaaggggtgaag
tcgaacccctccaagcgccatcgggaccggctgaactcggagctggagcggctggctggc
ttgttgcctttccccgaggaggtcgtctcgaccctggataaactctccatcctgcgcctc
agcgtcagctacctcagggccaagagcttcttccacattgctctgaagagtcactgcggc
aaagggggagcggaaaggagcggcgaccgtgacaagggaaggaccttgggacgggctgac
ggcatcctgcccgagggcgagctgctgttacaggcgctgaatggcttcgtgctggtggtg
acatccgaaggggagatattttattcctcgcacacgattcaagactatctggggttccac
cagaccgacgtgctgcaccagagcgtgtttgagctgatccacaccgaggaccagccggaa
ttcaggcgcaaccttcactgggccctcagcccgccccccgcgcccgagagcgccccgtcg
ccagagggtgacgtgggcgccggctcctcccttccggcctacgagcccggccagctgcct
cctgagaactccgctttcctggagaggagcttcgtgtgccggttccgctgcctcctggat
aattcctctggcttcctggctttaaaccttcagggcaggttgaagtttctccacggccag
aagcaaaggtccgaggacgggtctctgctgccgccccagctggctctctttgtcatctcc
acgcccttgcagcccccctccatcctggagatcaggaccaaaaacatgatcttccgaacc
aagcacacgctggacttcacccccttggcgtgcgacgccaaagggaagatcgtgctgggc
tacacggaggcagagctgcggatgcgcggcaccggctaccagttcatccatgctgccgac
atgctgtactgcgccgagaaccacgtccgaatgatgaagacgggcgagagcggcctgacc
gtgttccggctgctgaccaaaaacaacagctggaagtggaggcagggccaagccccgctc
nattacatcgtcgccacgcagaggccactcgcagaggaagaaggagatgatcaccttcgg
aagcgctccatgcacctgcctttcaccttcgctatgggagaggcgctgctgtaccagtct
gcctgcccctttcctggcttccccgagcctttgccgagcaaggggaagccccgcaaaccc
aaaaagcattctctggggaaagggggacggccccagaaggacagcgtggaccccaattct
ctcctgggagccatgatgaggcaaaatgcggcggtttacgtctcccacccggcttctacg
cccagacacgccgtcagccgcccgctcaccccccaccagggcagctcgggcttctctggc
tctggagaagacggctggagtggggtcgctaatgccttggcctctggagaaaccggtccc
aagcctgtactggctgatgggaggcccggggaccccctgctgggttctctctccagtagc
agtgaagaagcctgttccactcacgagatgtttgctgctttggaggggctggggctgact
gcggaggacctggagctcttgctgttggacgagaggatggtgagggtcgacctggacctg
gatcgtgttccgtcgctgaacgacctgttaacaaacaacgaaatcctctcctatgttcat
ggttcgctcgccagccgatgcgagggggggcccaccggggagcagcaggcctgtcccttg
tcaggtccggccccgaatccaagcccagacctgggggcatgtccatcccagatgccggag
gaaagatacccctgctcctcccagcccccaacccccctgatcttgcacctcccccagcaa
atgcagcagtgccttgcaagccaaagccctcggggcagccagccctgggagccgccgctg
ccctgcggtcgcagtcagcaagctgatgaggagcagccccccggcctgcagtggaggccc
cccgccggagcggctgaggtcgggccgtctcccgttggacaggcacccctgggcaatcgg
ccgcagggtccacagtgggtcagacctcctggatcaagacatctccatgagcccctggcg
cccccttaccaacagcagcaacccgcggcgccactggagagcagcccctatgccgggcca
ggagcagcggggccgttcctgcagcaaagccagccctgcctcccgccacgcccggcccag
gcgcacacggagccgctgagtcagctgatgctaaaacccgaccagcacttgctggtgaac
gggctggacgaccatgcctccgccagccggccggccctggggaacaacacatggcagcgc
tgctggcctgcgaatcagccgccccatgtctgcggtgtcgaacgggggcgcctctgtctg
tcccagctctgcccagctccagtgccaaacccaggcggggccgcccttcctttctacctg
gacgggctgcccagcacagggacgggcgctagaggagcctgccaagaggagatgactcct
tgtccgggttttgtccccccttcctcgtatcctccaaagccgccaacccctgttcctttg
gcgtcccagtacccagccttggagcactggggggctgcccaggggcagcaggaaggctcc
ctgcactcttgc

DBGET integrated database retrieval system