KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102446026
Entry
102446026         CDS       T02980                                 

Gene name
AHR
Definition
(RefSeq) LOW QUALITY PROTEIN: aryl hydrocarbon receptor
  KO
K09093  aryl hydrocarbon receptor
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Brite
KEGG Orthology (KO) [BR:pss00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pss03000]
    102446026 (AHR)
Transcription factors [BR:pss03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    102446026 (AHR)
SSDB
Motif
Pfam: PAS_3 PAS_11 PAS HLH PAS_4 PAS_9
Other DBs
NCBI-GeneID: 102446026
NCBI-ProteinID: XP_006139665
Ensembl: ENSPSIG00000010051
Position
Unknown
AA seq 832 aa
MYLYVVRTKPSPSEGVKSNPSKRHRDRLNAELDRLASLLPFPQDVITKLDKLSVLRLSVS
YLRAKSFFDVALKSSNYTRPEINGIQDNCRASKPGEGIHLLEGELLLQALNGFVLVVTAD
ALVFYASSTIQDYLGFQQSDIIHQSVFELIHTEDRPEFQRQLHWALNPTDSGQRIQGDNG
FSQPATYYNPEQLPPENSSFMERNFICRLRCLLDNSSGFLAMNFQGRLKFLHGQNKKGKD
GSPVSPQLALFTVATPLQPPSILEIRTKNFIFRTKHKLDFTPVGCDAKGKIVLGYTETEL
RMRGTGYQFIHAADMLYCAENHVRMIKTGESGMTVFRLLTKENRWAWLQANARLIYKNGR
PDFIIATQRPLTDEEGSEHLRKRNMSVPFMFATGEAVLYEAAFPLPGLMNPSQLKVESVA
VKGSAPKATLQKESVHPNSILGVMLSQDESVYLCPPASQKLSFDRNFFTDTSDELGNVIA
SDWQDNLLPTGNNILKHEQTDCPQDSNVMLTEDNAGLFQDNKNSDLYNFMRNLGIDLXEF
FKTEFSCVDDIGDIDITDEILTYVQDSLNNKPDFLYSACHRQQSIVQDSSCLVQQHLGQQ
QLNQHQKQVVEQHQQQLCQKMKHMQVNGMFTNWNPSSSVSFSCSQQKPVQYVFSDMPGTT
QELPYKSEVNPVPYACRQEFIPYKQPTRLEPQLSNFTQIDFPIGHFDRSTYPGSSRLEDF
LSSQQENQVCGINSQSVMITPQTCYAGAVSMYQCVPETQPNSMDQMQYNSMMEGQQLLLN
KFQNGFSGINVNEAYPSQLDVISNTQTATNLQPLHHPTESRPFSDLASGGFM
NT seq 2499 nt   +upstreamnt  +downstreamnt
atgtacttatatgttgtcagaacaaagccatccccatctgaaggagtcaaatccaatcca
tccaagagacacagagatagattgaatgcagagttagatcgcttggctagcctcttgcct
ttcccacaagatgttatcaccaaactggataaactctctgtgcttaggcttagcgtgagt
tacctgagagccaaaagtttctttgatgttgcattaaaatcttccaactatacaagacct
gagataaatggcattcaggacaactgcagagcaagtaagcctggagaaggcatacatctg
ctagaaggagaacttttgttacaggcattaaatggctttgtactggttgttacagcagat
gctctagtcttttatgcctcttcaaccatccaggactatttggggttccagcaatctgat
attatacaccagagtgtatttgaattgattcatacagaagatagacctgagtttcagcgt
cagcttcattgggcattaaaccctacagattctggacagagaatacaaggagataatggc
ttttcacagccagcaacctattataacccagaacagcttcctccagagaattcttccttt
atggagagaaattttatctgtagattaagatgcctcctggataattcatctgggttcttg
gccatgaattttcaagggcgattaaagtttcttcatggacagaacaagaaagggaaggat
ggctctcctgtctctcctcagctggctctatttacagtggctacccctttgcagcctcct
tcaatccttgagatacgaaccaaaaacttcattttcagaactaagcacaagctggacttc
acacctgtaggatgtgatgcaaaaggaaagattgtactgggatacactgaaacagagctg
cgtatgagaggaacaggatatcagtttattcatgcagctgacatgctttattgtgctgaa
aatcatgtccgaatgataaagactggagagagtggcatgactgtgtttagacttcttacc
aaagaaaatcgctgggcctggcttcaagcaaatgcacgcctgatctacaaaaatggaaga
cctgattttatcattgcaacacagagacctcttacagatgaagaagggtcagagcattta
cgaaagcgaaacatgtcggtgccttttatgtttgcgactggtgaggctgtgttgtatgag
gcagccttccctttgcctggcctaatgaatccctcacagctgaaggttgaaagtgttgcc
gtgaaaggatctgctcccaaagctacactacagaaagaatctgttcatccaaactcaatt
ctgggtgtcatgttaagtcaagatgagtctgtatatctctgccctcccgcttcacaaaaa
ctttcctttgacagaaacttctttacagacaccagtgatgaactgggcaatgttattgcc
agtgactggcaggataatctcttaccaactggaaataacattctgaaacacgagcaaacc
gactgtccccaggacagtaacgtaatgcttactgaagacaatgcagggctctttcaagat
aacaaaaacagtgacttgtacaacttcatgagaaatctgggtattgacttannagagttt
tttaaaactgaattttcttgtgtggatgatattggagacatcgacataactgatgaaatc
ctgacctatgttcaggattccctaaataataagcctgacttcttgtattcagcttgtcat
cggcaacagtcaatagttcaggactctagctgtttggtacagcaacatttgggtcagcag
caacttaatcagcaccaaaaacaagtggttgagcagcatcagcagcagttatgtcagaag
atgaagcatatgcaagtcaatgggatgttcacaaattggaaccctagtagtagtgtgtct
tttagctgttcacagcaaaagccagtgcaatatgttttttctgatatgcctggcactact
caagagctcccttacaaatcagaagtcaaccctgtaccttatgcatgtagacaagagttt
attccttacaaacagcccacaaggctggagccacagctttctaattttacccaaatagat
ttccccataggacattttgacagatcaacctatcctggttcttcaaggttggaggatttt
ctcagttcacaacaagagaatcaagtgtgtggaatcaattctcagtcagttatgataact
cctcaaacatgctatgcaggggctgtttctatgtatcaatgtgttccagaaacgcaaccg
aactctatggatcaaatgcaatataattctatgatggagggtcaacaactgttgttaaat
aagttccaaaatggtttcagtggaataaacgtaaatgaagcatatccctctcagttagat
gtcatcagtaacacacagactgccacaaaccttcaacctcttcatcatccaacagaatcc
cgacctttctcagatttggcatccggtggatttatgtaa

DBGET integrated database retrieval system