KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102446054Help
Entry
102446054         CDS       T02980                                 

Gene name
DHX8
Definition
(RefSeq) ATP-dependent RNA helicase DHX8 isoform X1
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:pss00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    102446054 (DHX8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pss03041]
    102446054 (DHX8)
Enzymes [BR:pss01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     102446054 (DHX8)
Spliceosome [BR:pss03041]
 Complex C
  Other components
   Step II factors
    102446054 (DHX8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 S1 Helicase_C DEAD AAA_22 T2SSE AAA_19 Transformer DUF4770 AAA_30 Flavi_DEAD AAA_16 Spem1 PhoH Sigma54_activ_2 Presenilin
Motif
Other DBs
NCBI-GeneID: 102446054
NCBI-ProteinID: XP_006125769
Ensembl: ENSPSIG00000005550
UniProt: K7FD65
Position
Unknown
AA seq 1116 aa AA seqDB search
MRPPGKPSTGKAEAVVKPKTEKEKLKDLFPALCRPDNPTIRTMLDEDDVKVAADALKELE
ALMPTAGGKAKQRNTDHRTKKKRRSRSRSRDRDRKRRHRSRSRSRSRTRDKNKGKSRYRS
RSRSPSPSRDRKDREKYTEKSNDRWRDKHVDRPPPEEPSIGEIYNGKVTSIMQFGCFVQL
EGLRKRWEGLVHISELRREGRVANVADVVSKGQRVKVKVLSFTGSKTSLSMKDVDQDTGE
DLNPNRRRNIVGETNEETSMRNPDRPSHLSLVNAPEVEDDSLERKRLTRISDPEKWEIKQ
MIAANVLSKEEFPDFDEETGILPKVDDEEDEDLEIELVEEEPPFLRGHTKQSMDMSPIKI
VKNPDGSLSQAAMMQSALAKERRELKQAQREAEMDSIPMGLNTHWVDPLPDVDGRQIAAN
MRGIGMMPNDIPEWKKHAFGGNKASYGKKTQLSIIEQRESLPIFRLKEQLIQAVHDNQIL
IVIGETGSGKTTQITQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGY
TIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKT
VQKRPDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITV
MQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRI
FDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQA
KQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFD
FMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEE
MLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYE
NFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKATVRVQKAICSGFFRNAAKKDPQEGY
RTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVS
DPTKLSKQKKQQRLEPLYNRYEEPNAWRISRAFRRR
NT seq 3351 nt NT seq  +upstreamnt  +downstreamnt
atgcggcctccaggaaagccatctacaggcaaagcagaggcagttgtcaaacccaaaaca
gaaaaggaaaagctgaaggacctgttcccagccctttgcaggccagacaatcccactatc
aggactatgctggatgaagatgatgtgaaagtagctgctgatgctcttaaagaacttgaa
gctttaatgcctactgccggtgggaaggcaaaacaaaggaatactgatcaccggacaaaa
aaaaagaggaggagccgcagtcgcagtagagacagagacaggaaacggaggcaccgatcc
cgttccaggtcccgttctaggactcgggataagaacaaggggaaatccagataccgctca
aggagcaggagtccgagtcccagcagggaccgtaaggatcgagagaaatacacagagaag
agcaatgatagatggagggacaagcatgtggatcggcctccacctgaagagccttcaatt
ggagaaatttacaatggcaaagtcactagtataatgcagtttgggtgctttgtgcagctg
gaaggactaaggaaacgctgggaaggcttggttcatatttctgaacttcgcagagaggga
cgtgttgctaatgttgctgatgttgtgagcaaaggacaaagagtaaaggtcaaagtgctg
tcattcactgggtccaaaaccagcctgagcatgaaggacgttgatcaagacactggggaa
gatttaaacccaaaccgacgcagaaacatcgttggagagaccaatgaggagacctcaatg
aggaatccagacagacccagtcacctctccctagtgaatgcccctgaagtggaggatgat
agccttgaacggaagcgtctcacccggatttcagacccagagaaatgggaaatcaaacag
atgattgctgctaacgtgctctccaaagaagagttccctgactttgatgaggagactggc
atcctccccaaagttgatgacgaggaagatgaggaccttgagattgagctggttgaagaa
gagccgccgttcctgcgagggcatacaaaacaaagcatggatatgagtcccattaaaata
gtgaagaatcctgatggctccttgtcccaggcggccatgatgcaaagcgcgttagccaaa
gaaaggcgagaactcaaacaagctcaaagggaagccgagatggactctattcctatggga
cttaatacacattgggtggatcctctacctgacgtggacgggagacaaatagctgccaac
atgcggggtattgggatgatgcccaatgatatcccggagtggaagaaacatgcgttcggt
ggcaacaaagcctcctatggtaaaaaaacccaactttccatcattgagcaaagggagagc
ctcccaatcttcagactaaaggagcagctgattcaggcagtccatgacaatcagatcctg
atcgttatcggcgagacgggctccgggaaaacgacacagatcacccagtacctggctgaa
gcaggctacaccacgaggggcaagattggctgcacccagcctcgccgagtggctgcaatg
tccgttgccaagagagtgtccgaggagtttggctgctgtttgggacaggaggttggctac
accattcggtttgaagactgcaccagccccgagacagtcatcaagtacatgacggatggt
atgttactgcgggaatgcctgattgacccggacctgacccagtacgccatcatcatgctg
gacgaggcccatgagaggaccattcacaccgacgtgctctttgggcttctgaaaaagaca
gtgcagaaacgtccggatatgaagctgatcgtaacttcggcgacattggatgctgtgaaa
ttctcccagtatttctatgaagccccaatcttcacgattcctggcagaacataccctgtg
gaaattctgtacacaaaagaaccagagactgattatctggatgccagtctgatcacagtg
atgcagatccatttgacggagccaccgggtgacatcctggtgtttctgacgggtcaggag
gagattgacacagcttgcgagatcctctatgagagaatgaaatcgctaggacctgatgtg
cccgagttaattatcctcccggtatattctgctttacctagtgagatgcagaccaggatc
tttgaccccgccccgcctggcagcaggaaggttgtcattgctaccaacatcgcggagacc
tccctgacgattgacggaatctattatgtggtggatcctgggtttgtgaagcagaaagtt
tataactccaagactggaattgatcagctggtggttacgcccatttcccaggcgcaggca
aaacagcgagccggaagagctgggagaacaggcccggggaagtgctacagactctacacg
gagcgcgcttaccgagatgaaatgctaaccaccaatgtgcctgaaatccagagaacaaac
ttggccagcacagtgctctccctcaaggcgatggggatcaatgacttgctctcctttgat
tttatggatgctcccccgatggaaacgctcatcactgccatggaacagctctacaccttg
ggagccctggacgacgagggcctcctcactcgacttgggcgccgaatggcagagttcccc
ttggagcccatgttatgcaagatgttgatcatgtcggtgcacttgggatgcagtgaggaa
atgttaaccatcgtctccatgctgtccgtacagaacgtgttctacagaccaaaggataaa
caagcacttgctgaccagaagaaagccaagttccaccagacagaaggggaccacctcacc
ctgctggctgtctacaattcgtggaagaataataagttctcgaatccctggtgctatgag
aattttatccaggcccggtccttgcgcagggcacaggacatccgtaaacaaatgctgggc
attatggacagacacaagcttgatgtggtgtcatgcgggaaggccacggtgcgagtccag
aaggccatttgcagcggtttcttccgaaatgcagcaaagaaggacccccaggaaggctac
cggacactcattgaccagcaagtagtctatattcacccatccagtgcccttttcaacagg
caaccagaatgggtggtctatcatgagctagtgctgaccaccaaggagtacatgcgcgaa
gtgaccaccattgacccgcgctggctggtggaattcgcaccagccttcttcaaagtctct
gatccaaccaaactgagcaaacagaagaagcagcagcggctggagcccctgtacaatcgc
tatgaggagcccaacgcttggaggatctctcgtgccttcaggagacgctga

DBGET integrated database retrieval system