KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102446083
Entry
102446083         CDS       T02980                                 

Gene name
AHRR
Definition
(RefSeq) aryl hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Brite
KEGG Orthology (KO) [BR:pss00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pss03000]
    102446083 (AHRR)
Transcription factors [BR:pss03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    102446083 (AHRR)
SSDB
Motif
Pfam: PAS PAS_3 HLH PAS_9 PAS_4 PAS_11
Other DBs
NCBI-GeneID: 102446083
NCBI-ProteinID: XP_025035493
Position
Unknown
AA seq 753 aa
MIPPGECLYAGRKRRKPIQKQRPAIGNEKSNPSKRHRDRLNAELDHLASLLPFPPDIISK
LDKLSVLRLSVSYLRVKSFFQAIQEKHCRKQVGHTIKDYQSSETTIPEGGLLLESLNGFA
LVVNADGMIFYASSTIADYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMNPPQLMSG
QQPQTETGEEYILSKLFKAQEGDSMSTDYSSFLTRCFICRVRCLLDSTSGFLTMQFQGKL
KFLFGQKKKSSSGTLVPPQLSLFCIVAPLMLPSVTELKMKSLLVKAKHRADEEATMDTNS
KSISGLCETELQGRTSYHEGAAFSNVLQSAENQAKANNGENGISLFKVLTNEDHWVWLQT
NTQVLYRTGCSEYVIASQQALKEEDVHLKVPKNITSLKGHKDALTYNCAIETLGQMKHLN
WTSVKNAQDSIKVKFEPNTNEKCFMQEGSLNSNTLLLGVQNNCNTNSIWTLKNSSNSCSV
NQRINTCPSRKIGPFCNRDQNLLNLASNFPSHWGTTENCQSYSGLQQFTGENYTTDPVKL
QRPVLYPETLYDTVFPLDMPIKTEYDSDSENVADSYTMSQSRVWVDENGTVKKQLTGYPN
TMHLKTESDHNEQLSPCQKPKNCVYTPHNWQCIVTNHANNMNINRSCRGLHNKEMAQVCP
QNSAYLESIHDFQRTEFYNQFYSANLVDEKVQNNQFLKMQCEFKNPSLVHTIKREPLDSP
PLSDNGQDGLEMIFPDNAPGPVPQETTECTFLQ
NT seq 2262 nt   +upstreamnt  +downstreamnt
atgatcccaccaggggaatgtctgtatgctgggaggaaaaggaggaaacccattcagaaa
caaaggcctgccattgggaatgaaaagtctaatccttcaaagaggcatagagaccgtctg
aatgctgaattagatcatctggccagcctccttcctttcccacctgacataatatctaag
ttggacaaactttctgtcttgcgtcttagtgtcagctatctccgagtcaaaagcttcttt
caagccatccaagaaaaacattgtaggaagcaagttggtcacacaataaaagactaccaa
tccagtgaaactactataccagaaggtggactcctgctagaatcactaaatggctttgca
ttggtggtgaatgcagatggaatgatattttatgcttcctcaactattgcggattatcta
ggctttcatcagactgatgtaatgcatcaaaatatatatgattatattcatgtggatgat
cgccaagatttctgtagacaactacactgggccatgaatcccccacaactgatgtctgga
cagcaaccgcagactgaaacaggagaagaatatattcttagtaagttgtttaaggcacaa
gagggtgacagcatgtcaacagattattcttcttttttaactcgttgtttcatctgccga
gttcgctgccttttggacagtacttctggtttccttacaatgcagtttcaaggtaaactg
aagtttctctttggacaaaagaagaaatcctcctcaggaacactagtaccacctcagttg
tccttattctgcatagtggccccgctcatgctcccttctgtgacagaactgaagatgaaa
agtctgcttgtaaaagcaaagcaccgagctgatgaggaagccacaatggatacaaattca
aaatccatttcaggcctatgtgaaacagaattacaaggaagaaccagttaccatgagggt
gcagctttctctaatgtgttacaaagtgctgaaaaccaggccaaagcaaacaatggagaa
aatggcatttctttatttaaagtactaacaaatgaagatcactgggtctggctacaaacc
aatactcaagttctgtacaggactggctgttcagaatatgtcattgcctcacagcaagct
ctaaaggaggaagatgtgcacctgaaggtaccaaagaacatcacaagtttgaaaggacac
aaggacgcacttacctataactgtgccattgaaactttgggacagatgaagcatcttaac
tggacaagtgtaaaaaatgcacaagacagcataaaagtgaagtttgaacctaatacaaat
gaaaagtgtttcatgcaagagggatctctgaattctaacacattacttttaggtgtccaa
aacaactgcaacacgaacagcatttggactttaaaaaattcatcaaattcttgttctgta
aatcaacgtatcaatacatgtccaagcagaaaaattggaccattctgtaacagagatcaa
aatcttttaaatttagcatcaaactttccttcccattggggtactacagaaaactgccag
tcttattcaggcttgcagcaatttactggagaaaactacactacagatcctgtcaaatta
caacgtccggtgctgtatccagaaactttgtacgacacagtatttcctctagatatgccc
atcaaaactgagtatgattctgactctgaaaatgtagctgatagctacacaatgtcacaa
agtcgagtctgggtggatgagaatggtacggtgaaaaagcagctgactggctaccctaat
acaatgcaccttaaaacagaatctgaccacaatgagcagttgtctccttgtcaaaagcca
aagaactgtgtttacacaccgcacaattggcaatgcattgtaacaaatcatgccaacaat
atgaatataaacagatcatgtagagggttacataataaagagatggcacaggtttgcccc
cagaactctgcatatttggaaagcatccatgactttcagcgtactgaattctacaatcag
ttctatagcgccaatttggtagacgagaaagtgcaaaataaccagtttttaaagatgcaa
tgtgagtttaaaaatccctccttggttcacacaatcaagcgtgaacccttggattctcca
ccattgtctgataatgggcaggatggactagagatgatcttccctgataatgcacctggt
cctgtgcctcaggaaacaacggaatgtacatttttacaatag

DBGET integrated database retrieval system