KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102446226Help
Entry
102446226         CDS       T02980                                 

Gene name
TMPRSS15
Definition
(RefSeq) enteropeptidase
  KO
K01316  enterokinase [EC:3.4.21.9]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Brite
KEGG Orthology (KO) [BR:pss00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pss01002]
    102446226 (TMPRSS15)
Enzymes [BR:pss01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.9  enteropeptidase
     102446226 (TMPRSS15)
Peptidases and inhibitors [BR:pss01002]
 Serine peptidases
  Family S1: chymotrypsin family
   102446226 (TMPRSS15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin CUB MAM SEA Ldl_recept_a DUF1986 SRCR_2 SRCR XFP_C
Motif
Other DBs
NCBI-GeneID: 102446226
NCBI-ProteinID: XP_006128902
Ensembl: ENSPSIG00000016555
Position
Unknown
AA seq 1015 aa AA seqDB search
MNLKKSLSKRGIPLNDFEIWLAALLAIFVCVCAGLITLSWLLIKESQQGNHAATGTFKIL
SGASFSPSLEDNSSADFKALAFDIQQLITEIYQASQLKNEYKNSEVLLFKNGSIIVVFRL
NFAQWVSNEKAKNELVLGIEANKTSLLKTINIDVNSIEVTEQLTTSNSSTTSVISVKCLP
SEESCADAINCISKNLYCDGLPNCPDGSDEIDSICATTCDGKFMLTGSSGSFHSINYPKP
YNSNIVCQWIIRTNHGLSIKLNFTSFDTQQYTDILNIYEGTGPSKILRASLWGTNPGTVY
IFSDEATAEFITDYSENYNGFNATYTTFHTSELSNNEKINCNFEDSFCYWSQDLEDDGEW
ERISGPTFPFMSGPDYDHTYGNLSGFYISTPIGFTTRQQRVRLFSLPLVPASDPFCLRFW
YHMYGTNVYRFSIKITNSNNMEKTVFQREGNYGNNWNYGQVTLNETSNFKVIFDAFKNPG
LSDIALDDIGLTSGKCKESIYPEPTVVPTTTTPSPLPTDCGGPFELWEPNTTFSSKNYPN
NYPDQASCIWYLNAEKGKNIQLHFQYFYLEDIYDVVEIRDGRGNNSLFLAVYTGQNSVPD
VYSTTNQMTVLFITDKSGTRKGFLANFTTGYNLGMPAPCGPKDYQCGSGECIPLDNLCDG
HLQCKDGSDETECVHLFNGSLSVNGLVQFRIENKWYIACADYWSEQISNDVCNALGLGNM
NTSSTMSTTGNGPFVKITKAANQSTILMPSKQCLNNLVMYLQCNDKPCGKQLITQQINGK
IVGGSDAKEGAWPWVVSLFFKDRPTCGASLLSDEWLVSAAHCVYGRNLIPSQWKAVLGLH
TTLNLTYPQTVIQEIDQIVINPHYNKRTKNNDIAMMHLQFKVNYTDYIQPICLPEASQQF
LPGINCFIAGWGRTVYQGSTANILQEAEVPLITNEKCQQQLPQYNITENMMCAGYDEGGV
DSCQGDSGGALMIQDNSRWLLAGVTSFGYQCALPQRPGVYARVTQFVDWIKQFIH
NT seq 3048 nt NT seq  +upstreamnt  +downstreamnt
atgaatctgaaaaaatcattatctaagagaggtatccctcttaatgactttgaaatctgg
cttgctgctctgcttgcaatttttgtgtgtgtttgtgctggattaattacactttcatgg
ctactaatcaaggagtcacaacaaggtaatcatgcagccacaggaacatttaaaatactg
tcaggagcatcattcagccctagtttggaagacaactcatcagctgacttcaaggccctt
gccttcgatattcagcaattgataactgaaatctatcaagcaagtcagctgaagaatgaa
tataagaactctgaagttttgctgttcaaaaatggcagcattattgtagtattccgccta
aactttgcacagtgggtctctaacgagaaagcgaagaatgaactggttttaggtattgaa
gcaaacaaaactagccttttgaagactattaatattgatgtaaacagcatagaagtcaca
gaacaactcactacaagcaattcttcaacaacttcagttatttcagtgaagtgtttacct
tctgaggaatcttgtgctgatgccataaactgcataagtaaaaacctatattgtgatgga
ctacctaactgcccagatggttcagatgaaattgacagtatatgtgctacaacttgtgat
ggaaaatttatgttgactggctcctctgggtctttccactctattaattatccaaagcct
tataattcaaatatcgtttgccaatggattatacgcacgaatcatggattatcaattaaa
ctaaacttcacttcctttgatacccaacaatacacagacattttaaacatttatgaaggt
acaggaccaagcaagattttaagagcttcgctctgggggacaaatcctggaacagtttac
attttttctgatgaggctacagcagagtttattacagattattctgaaaattataatgga
ttcaatgcaacatataccacatttcataccagtgaactaagcaataatgagaaaattaac
tgcaattttgaggatagtttttgttattggagtcaagatttagaagatgatggtgaatgg
gagagaattagtggtcctacttttccttttatgtctggccctgattatgaccatacgtat
ggcaacttgtcaggattttatatttcaacacccataggatttacaacaagacagcagaga
gttcgactttttagcttgcctttagttccagcatcagatccattctgtctacgtttttgg
tatcatatgtatggtactaacgtttatcgcttcagtattaaaatcacgaatagcaataac
atggaaaagactgttttccagagagaaggaaactatggaaacaactggaattatggacaa
gtaaccttaaatgaaacatctaattttaaggtgatttttgatgcatttaaaaacccaggt
ctgagtgatattgctctagacgacattggcctgacaagtggaaagtgtaaggaaagtatt
tatccagagccaactgtagttccaacaaccactactccatctccacttcccactgactgt
gggggaccatttgaactctgggaaccaaacactacattcagttctaaaaattacccgaac
aactaccctgaccaagcctcttgtatatggtatttaaatgctgaaaaagggaaaaacatt
caacttcattttcaatatttttacctggaagatatctatgatgtagttgaaatcagagat
ggaagaggaaacaattctttgtttttagctgtctatacaggacaaaactccgttccagat
gtctactctaccacaaaccagatgacagtgctcttcattactgacaaatctggaactcgg
aaaggatttcttgcaaattttacaactggttataatcttggaatgcctgcaccctgtgga
cccaaagattatcagtgtgggagtggggaatgtatacccctggataatctttgtgatgga
catttgcagtgtaaagatggctctgatgaaacagagtgtgtacatctgtttaatggttct
ctaagtgtcaatggattggtacagttcaggattgagaataaatggtatatagcatgtgca
gattattggagtgagcagatttcaaatgacgtttgtaatgcattaggactagggaatatg
aatacatcatcaacgatgtcaactactggaaacgggccatttgtgaaaatcaccaaagca
gctaaccagagcacaatacttatgccaagcaaacagtgtctcaataatctggtgatgtat
ttgcaatgcaacgataaaccttgtggaaaacagctgataacccagcagatcaatggaaag
attgtaggtggaagtgatgccaaagaaggagcttggccttgggtagtctcactgtttttt
aaggataggcctacatgtggagcttccctcctcagtgatgaatggctggtctcagcagca
cactgtgtatatgggaggaatttaataccatctcagtggaaagcagtgcttggcttgcac
accactttgaatctgacttatcctcagacagtaattcaagagatcgaccaaatcgtcata
aatccccattataacaagcgcacaaaaaataatgacattgctatgatgcatcttcagttc
aaagtcaattatacagattacatacagcctatttgcttacctgaagcaagtcaacagttt
ttgccaggaattaattgctttattgctggctggggtagaactgtgtaccaaggttccact
gcaaacatactgcaagaagcagaggtccctcttataacaaatgagaaatgtcaacaacag
ctgccacaatataatattacagaaaatatgatgtgtgcaggctatgatgaaggaggagta
gattcctgtcagggagattcaggaggagccctaatgattcaagacaacagcaggtggctt
ttggcaggtgtgacatcctttggctatcagtgtgcactgccccagcgtcctggagtgtat
gctcgagtcacacaatttgtggactggataaaacaattcatacattag

DBGET integrated database retrieval system